MZ@ !L!This program cannot be run in DOS mode. $6r}Ür}Ür}Ü4,"p}Üs}Ü/A}Ü/#}Ü/"G}Ü{@{}Ü{PW}Ür}œRÜ)"}Üs}Ü/s}Ür}Ts}Üs}ÜRichr}ÜPEL>"W"  $}@p%s#%@@@L |p (|$q+ pH @.text `.rdata@@.datat R @.rsrc(|p ~ @@.relocq$r$@BDAL跢hYC,YY9hcCY8hiC YhnCYM,hsCYhxCYQh}CYáSLQ@SLP_hCY1hCYshCYgLhCwYùdLehCaYSVWj [lGKyNlGN(GV Y_^[SV3Wj_NN(^^ ~^^^ ^$ef^8NlF:^<^@FLFPFTFXF\F`Fddj F|Udž[dKy󃎌3lptx|f_Ɔ^[V4HWLPtXLj0^U]dUWLVuWVl XL8u/;u 6EȋE Qu j VH_^]w3@U W} tVu9=tXL3dXLFEeepXL=tXL5xXL}uejjMQPVHPudXLH=lXLhXLuu(HlXL^}_t}tju8PuH]U=lXLt%uH} lXLtG} tAuLHhXLt+PuH5dXL%hXLH%dXL tXL]uHU S] 3Vu3Wj_@EM}EePjWQV{ ~jUKCME 8 M͢t\HHHH7HH̡}EE MUE M;S |[EMpWVE_^[]}}tWVE 8t!EM9t9}ujWPV놋EUeSVW}3CEW](Hu lXLou3SuuW9^ ~4΍VEىU M8sS@EU ;F E|F ;t+PPCPW$HvuuW_^[];t +ˍQPCPW$HEU M؀tDuLMt uWzME 8tM@tEujPQWEU M#Eu MUuWL XL qP ju juH]UuWLMPP jjjuH]UQSVuWL!uWLVEЃMIIut-$XLtSu u\ ^[]xHuVu h8̠U\SVWuWL XLD$(P\$30HFx%hXLD$%dXL tXL xXLlXLpXLPF0HD$D$D$D$D$P3pHjt$t$W0HFXH@LyFVWVWu.\$ 63D$(P3,H_^[]ɟVWݤUuWLg U ȅtXLxu( WLEu QjuH] WLUSVuWLWV U E}3ɋ]9 XLbE ;wL++y PPSV};w)7;vvȁ83jWSV+KȁwIQ I {Ih>WSPVH_^[]VX3Ё3JJJuVWL XLj0(H~Lt~LWS@HjWa돋ȃNE+(  ˞IIIDj釞UuuR+t#I4Iu-V&SVPWPVIt IIQQVwj~jwQj髞UVW}ΉMt^;u>VE Yt[jj7XH_^]uΉMt9t΋6UM$uE(@S]#E(VW} jQuWSuuQhHhHPu u ENLfEh fffQU3Yx xp8t99u1f _^[]$JO2ߋ UEVW3F98u[F E=~ E 7tEDEDG_F ^]}tM}tҍMȋ0UME PuaSVW}3S5XLu,7u(u$u uQuuP Ht$8]4tSjHPj0VH9!_^[]0%U8SVuW~:m] EEP64HMԋE؋VD~HME U}EP3HEԋM+U؉EE+ЉEEP6UMpH}EuM}fE} fEE}fEE} fft(Efu~E+;t'Ef`uE +;U @_^[] } fFXffF\ft_fF`ffFdfEP74H9^Xt=9^\tEEP7H9^`A9^dJ{8}tfEffEfU존WLMqEtAXE tA\E~A`E~Ad]UQXLVuWj8W c 4XLjZU;$XL0F;G {r:VW~dk~hs~D{~P>t 6t Wj6HM,j_^[]4EtsPWyYsTWbW뿃eLCCCC"C@C|CCCCBC^CC+CnCCCCCTCrC.@/CCCC6C&.@^CCU}VuNlF`^f@h]uFlUQQEWLPEPuStKM$XLW8u8S] Cw0)0@$ 0@juuSW3@[_] 333I0@/@bCCCDC0@U@xRLV3XLjE0E+uEE؉u0HEEEE E܍EPuEHĖ@$HhHfRLHXLEPEE;Hjjj!jjHh5XL\XL(HPj5\XLH5`XL^] V XL XLuq(=@XLu=WL^áAdESt@A`t.W3$Ht3@[_^]3MF;ur3V~ щ^UVW3j 9~t.JYt uLFGFxF~_^]Yt u>V6sVmYY^USj ccYtVuW_^[]3VWNxuYF| ~tNSHH1fpNTF|%N$%N%VY_^QyFfx뛋NptQ]YSV3WN~^^ ^BN$BNT^4^8^<^@^D~H~L^PB^dƉ^h^p^xF|fffff_Ɔ^[USVj[F 9Ft&SYtOM NFF^[] jX;s(3ɉF W QI~Y~_먋3VW3H9~vF4FY$G;~rvfnY_^USVj[F 9Fu0 jX;sL3ɉF W Q~Y)~_SYtM NFF^[]3VNVF4FYN^$VW39~f_^VHvY^UQQEHPjhDH f}1]UQQ}SVtrutk33fEPjSRQHuQE W<E}PVSSuu HuEE;E s3f FuH_^[]3fD72U].RLtPuMEhH]]]]M RLEĈXhHM&Fj5RLMȉ]ԉ]؈] M !VRLXHEPMZhpHME3EVjPEPLM h`HMEuEEVVEPEPqLME M^`uM=EPMW}WhDHvYYWhHaYY%WhHLYY,WhH7YYu;aRLEPMERLPOGEPM=RL-MYNQjSWe 3u@EjPEPSUMf_3~5EPMYGEWjPSfUM;_EPM?;|ˍMgM_MceMEWM?_^[]3GVW5 H3W5xRLWWjdh,PPhlHPPWW5xRLRLjPWWWWhPWhHW֋5HW5RLRLW5RL_^U8VWj0Hhj,H5(Hjc5xRLEh5xRLRLh5xRLRL֣RL(dLxjjjjjc5xRLDHeȡxRLeeEEERLEEP RLE0E#}ElHME36@$H5RLftRL5RLQ _^]U,VWM;3EEEPh4HEPu0HRL3bLG;EPQhRLhRL6bLRLbLEEPPh5RL`HuRL?EE5RLhRL}=RLu XLWSL=RLu XLs6PHM_^] |RLډ=|RLҹRL9RL9RL93RLRLRLRLRLRLRLRLRLRLRLSLRLRLRLRLRLRLRLRLRLRLRLU0 SVWFȉEE&F$f8!NPM\>333uu2ۉE2Wg<j Yf;j Yf;uMW@<Gfj Yf;tkUVu W}?'_^] XL3 XLXLVWhHXLXLfXLXLXL XL;hHXL;XL`4XLV4XLL4XL4YLXLXLYLXLYLXLYLj_XL YLXLYLXLYLXLYL3YL YL$YL0YL3Oy dbL3_f$ZL(ZL,ZL0ZL4ZL8ZLw;rtV_^[]J>v"J v$v&_^3[]9u雈鑈釈U} Er tt"} r 83]xujmxuj`3tt tjcj\VFuv 6YY^UEVjvYtF^]3VVYt VYu3^3@^A(t A0jRP]US]VW2E3d$G ;GO GD5 FAG rwWE E< t9< tPK }C9CrBS E  CKxjE Pkt } 0_^[]=AXCtyPC%tKAQPV蘺3}3sjEPhw7HE騆Eq_^[]USVMEPt uEP2,M^[]2USVM_EPFt6޴Yv_Y8_^]UVW}t>t9}t3N ςWWu~6蟴 _^] QQUQQEV@9Fr^]=AWPFPFų>YtNAQ6W:6>_US]3WPP{PPGW3PPHEt7VPvY3PPuVW3PPHHPQM VVijY^_[]M WUWO `G@PWE GO_]VjXPfFj߲YYt F ^3UU S]VuWtvtumUʃ G _+؋G]]‰E;|x;urqGEEEUm;V|;uwOΉw+ȰO MO_^[] gg SjRV7HϋGWËuU USVW~te] 3tF ;Ft'NF MGF ;r~_V^[]jE Phv6Ht֋E tωFF FF FVUQQjEPjj1HEU]VW39>u~~ ~~_^Ã>t6\H>USV3ۃE ShjSjhE0H>t3C^[]UQQSVWjjjF^uE~MvjSuNj_^[]Af@| f_3@ftf0t3UVFf0| f?u2jRYt,E HJHJ@ B ^]QH3uË tQ,USV3j?Yj0FZf;f;}'EfFf;~ftDf t8^[]f;}W>tG G 9WYj?Yj0Z_ĉ^Af?~2f0|UESVPWtXLb3_^[]UVW} E M4AfZvfarfzwV}E fAsf0f_tًw7|HW[ E xf u/juE _^] bL7PE x2jf,tf)tf tf=tf(tf]tftMj4`MWf98TUQQMSVu Wj0[j9Zj._f9^_^[]E~e}߃A}f}_Z}Z}DQxt X]B3j0QYf;r%j9Yf;wPBˉ>MG׸Na`}jAYf;b} Uj褘Ytsu΃jEEF&tj%[EH脩uNuj C7Yf}3uDAf;v2f;rj{E jUQMSVWu3ɋ} _CUf9 G|Of;tMP"3f9 G|Uf9TOt 3_^[Y]MPU(SVMWfE33}jdfEM] f9;${  {}ff}0sm.tmAa_ƃ$=D}g@$g@jOMMEPG}A9w}@E OMtGD@E PEPEPEPS<f} J_EP}GZ1u$3PMGM؉}4{fZv>far@fzw:M{E܍M@P\M؋E3f4A@EGfAfAsf0f_t}}fMuu|HEPMMEPf<{jM>MEPf}3MvM_^[] zEPEPEPS}&{MEP=}f9?GM}f<{=zjAOjNMMEPG}#t%j[EuPYuY_^[]jh$&IV 1j h|&IV} !j hD&IVe Iyjh%IVM Ep 3MQ'뚉sUVWG 9Gj 荘YS]fKfNFfK fN f?~+fuf [OG4G_^]f0|j,Ytz HJHJ@ B 뻍 jX;r3ɉG jZ QYtGtPwVQw5w _33UVxH\vY^UEVtWhv@~7jV#EtWΗY_^]V3jXjfZF Q.3ɉjf YYt F ^3USVW3Ex}WtIEE33ft,E}PEEf9Et!C_fu}u_^[]A܋EJF;rUVuyjt @P^]jUSVuWtstn]tgO .VE wVCP7貖 3f _^[] HFP]3ɉGjZ QYjjTUS]3WPP{GW3jPHEtDV3jZ Q褕YuVW3jjHM HPjVVY^_[]M CUSVuWt]M] ;YsRtF3;Aw>O rVEwVXP7袕 3f _^[] q+jjjU}Wir}uuu ujuh\Ht_]h 3UEu p0q1]UQQVWO irGj^9Gr%WfEfQG3ҋOfH_^]=ArrPG3ɉG QΓ?YtO MQ7V莔7跴7UQVu;sp^]PVVAY^UVRNU;sP^]HUEV3jZf@F Q{Y3ɉf^]US]WtcUM ;JsXqZ+ًO V3F;EGPM PEHOPHP萓_ O3ҋ^fH_[] HjYtL0G G@ÉGt@3ɉGjZ Q谒O MQ7V%7m3jXUV;u+qjju^]UQQEV@9Fr^]=AqFtHW3ɉFjZ Qȑ>YtN MQ6W舒6豲>_jXU}VtmuYN F%P1FEPu65 ^]B F@P3ɉFjZ Q%YjjUSWu蝯؋G YpGPOPuHP讑_ 3ҋOfH_[]UWO pQu_]UQSVW3ExWt5]3ft"EPEf9EtAKfuJF;rу_^[]USVu مt W};{r_^[]u3s+C ++ƍEP7APyPƐ )s7;CvVN  3Ƀf^fHjYt(jF 3XjZF Q荏Y3UVWu YFxtKG3ɉFjZ QM ?QuPj舏tF _^]jX3VW3FO ;_^HjJYt?0S_G Ct7C3ɉGjZ Qˎ Q7V蘏7[3jXUMVpQtItN ;s&0tff;u Ju3@^]tff;uNu؅tمt3@UVW}G9Fr_^]P>Ft6؎YF3jZ QJY3ɉf xUVN iS]W{~G9FrFEP36蒎 _[^]PR>Ft6_YF3jZ QэY3ɉf xHMAFAFA F UEt ]jXVj胍Yt F ^3UV;utu^]US]3WPP{GW3PhHEtGV3jZ QYuVW3jhHM HPjVVfY^_[]M U VF }^]3jZ Q贌Y3ɉF9N ~FAR$;N |SWF 23H~*F ыDMȉEnuF GH;|ڄu_[돋FM FMLUQSVW~ tuMu u|H~u^>tTw;u uEUtff; u4NuEE8uuEu=_^[]$u3ʋv 3NxM+E4x ~]C;~΋uN;ċE@dLE S`dL\dLEDdLEDdLWEXJ[g[g;0 tff;u Ou3@xN~HER]MU_@AË[IJ `dLJ \dL^J]ŋRtB;-} ]?ff;sBABzoUBE@J;8MEtff;EuxMEu;rnMAE@:Etvff;Et_ff;@M?B;[=2^]ff;sBABztEIu3o(DdL@dLhC賣UVVuu3^]USVSu}ur3upW}j ؃Yte{;ut u|j~豃YtBu gFff~3V3_F^[] 3u N33Uu8u]PM @UDSVWuW ‹N XLJH $8@΋+C_^[]ËΊ3:ދ]ED{'3뽋' v OjV@3@2둍I@ C@ @1@1@3CxC͊@HCC1@ZCCUQQSVWC G XLJHt0HeH'e]]At 3_^[]xϋo3;3@UQSVWh]Ł}YRV3ҋ  ~j Yj[B1; |]3ҋ~j[B1;|]3jZx3F Q7Y 3A9p~.<t5jYt%4ȋ@ F;p|_^[]3@$VFt%y65YV.Y^UEu  ]x ; D3USVu W]uc;} W_ ;M3Ʌ~0$.;"A;|W3ۅ~Hd$E8uEh ‰EЋ9NuɅG<tMEA_^[]Ë}™?} ‹] nb8jJt_j:tMhHRFF E_I4^A[]=tHSs333DUQSVuWb8tMt6ǀ~(U>R@}Iu܋Y ;3҅~)80;uB;|3҉U~LEE8u{Aݳ ڋEUЋEUEOuxcA uHj}t4u GG @<A_^[]ËË];3u 3UVuW} t#ǀ~S] s[Ou[3 @9 ~4Ⱥ   AAyTG; |Ӌ3ɺ@ Q|A39A~d$I@;A|_^]2UV@}E^]2SV,`39p6p|^@@[ǀ W@H^F _[^]@xtXuzwz ųUQQV~ tR]pEF ^]Ãy u u2ËAxwÃy u Af80t2@xuÃXuy Vu'AhH0VʤYYuh|HV蹤YYu2^ð^UVWF Ht]}S ]j[9_ ]'[_^]UQSVWG ^\^Hu=u~ ]jY9N +^,/_^[]H]HuMH?^USVWC tM`tQtLtGChH0V蕣{ t]EC uvK|^_^[]H w@$@uF uH4EMȋ;uH;uD3h|HVby;]~eC  {TXT@CC֖@)C*@UVEF ^]U SVW}7]ǀ[]Sj7 3Ej@&vt~ KOKOC G ]EVjP3}Et!G G 8\WBvEFEE;ut_^[]3떋VNu^Qf^UVW39~t_^]ËF Hu4j lP6Y jEuYtlQ]~HF]HA\lQQ$h*IPVW~uF }5_F ^ËG G 8t'W6uFF |˃ w$,@7uw uŐCӘ@Ә@CӘ@C)CBClClCWCUVW}G F u _^]Hw$@_^]jtЃtMG HJHJ@ B _V^]_^]jst7_^]33yu@C@@ԙ@u@u@Cʙ@CC_CCCCUV~ t?sjF [sYt2E HJHJ@ B V^]uN3UV~ .]jF r}Y0]tu F^]33@9A ty t3ËA Ht;Ht.H]Htt HH\39ËAx\ A\9\UQQA \tHu]HtHu Hu*AtJjU6^EYRY3UA Ht Ht5Hu]]EH\A\RmY)]EUQQVF Ht7HtPHtH\Vf80t$P聙Y^]\$n^Hx\Xu\VUy t3];Eu3@UVuf^]VW~t/G G 8u7}qw uqWlqFF }_F ^à w$@tQ_F ^ÍI@Ҝ@Ҝ@MCҜ@bCqCCCCCUS]V;tE~ tGW~uRF \\t]e\HHtB&SF _^[]{ usNSWupfY뚋>tO \tQUVjoYtuFF ^]3UeEeVEVPu ulxME3Ml^] UU4VBFBFB F ^]UdLL$VW}3jfD$\|$$D$(D$ D$,fD$0nЉD$ ,u BT$TUD$PD$B@ D$\sD$|$L$`@AL$<@A`dLA\dLA@t$Lu L$PVu!)iUE;tSrt$@Bft?3Ot0Xw"L@$@I'@t$L$YT$ek0pPJ|$$D$(3D$|$jtIrRmօu_^]t$$D$dLt> 8w?G dhdLG t$$D$Ft$$|$L=bLE E@D$C=bLe5bL>' @dLD$e`dL\dLD$jgjȃ;1D$AD$D$TD$PH ? u |$ D$(}D$ t$$D$dLt> Uw\G _hdLG nt$$T$E Ft$$E@ND$LH`F N`D$LF u [D$5pbLt$4d @dLD$b`dL\dLD$8DdLD$`DdLPNT$Hbb;L$4 tff;Nu3t$4T$HD$|$L$`FApbLL$8@A pbL`dLA pbL\dLAcpbLc@.cL$8D$H-D$4;AS3BFD$0dHL$<;vʉT$<D$VfO4VAM AM trRdփt$T$T$T|$X]D$YL$PAM H|$$D$K|$-jcV hdLFXD$FƉD$D$(Eu D$$PDfxGQ|$$|$-D$ D$D$dHD$hD$lD$p0@ D$x _Hf@ WD$hdL@ #D$-t$$D$dLt ~EhdLT$E Ft$$E@ ~ ND$LKKF KjF ^ЃSD$L HJHJ@ B Vu D$ ,LUEt,LD$RD$ t$AM RD$=dLtx T8L$hdLD$-VNA8FA/AM GD$8I=dLHUF F 8JUV)^GA M AD$M t$H)@$Ķ@AM |$-D$=dLt"=dL&L$hdLD$-|$-t$$D$(|$ D$}VP$DŽ$^$+L$u]u uhX|$VVqF |$YD$V|$XVD$YL$P$8u EU'KMAM NF F 8=VX\GUBfx@VA;vV$D$t9t$t hdL|$AM jb[hdLFD$@։Ft$$T$T$(AM cL$hdLD$-YhdLL$$D$nFL$ NF|$ D$(F u }D$6[v [ $@hdLL$$D$EƄ$L$ $Eu |$ D$(}D$!AM sAM alZ։Ft$$T$T$(dLhCdLdLdL:yhdLL$$D$ Eu L$ }BGDL$ P2[4tTx 0 F=dLQQ]D$@hdLL$$D$DE E@L$ \$@jDD$@|$ D$(F u }D$=dLuZEjjhtL$ $Pu~A3҉T$38re33@3_@8?@8K@83Dr3@!3t$@@t@@C DD-D D@ I@@.@@s@@ǵ@ D^@@D8@@DD@E D@@ D@0 DZ Dk D D D DU} SVW\EtuuHσENRGIȉEE]@E CTu} t bL};>r E _^[] CUSVWTt 3_^[]uPPSPvݥUVuWF0~SFpv_^]UE3ɋU SVXW:4FGt1Ht/t6u t @tGԃ>t>&3_^[]AIx̃>*ɋU4SVW}O W‹E9SG 0 '] K P$(@+ { h{{ CpN G ;$NXV{{ { TK3C _^[] { V{V3O F XLJ;UF RWA{W3N_F WF {t{ CX{  TC K3_^[]BMrRTSEwG ? {  X{ Q G M XLJ;XUG ;Au{3N\F X{ cCx}3F u G QNR{{ s~t-NRF  RVF R{C l{ Cx}3F u 60.NR{8{ Us~t$VQ{C /3H |@$h@G zRt]EF { {{{ CpN A>NfRTO ;Ot]"EF ϋv;{jV3{ CpTI $@U0{ >{R3F /v΋G;RjjP{H{ 0KqtQ;sC O ;P]EF H $@{{={S3r Q]]{EF E ʋǙ;E O;O>@H $@UE ME ;E M;MCxK@Y@Cx{ PSA Y@{tP3F 83_^[]@A{ Ct@p6U z T+Tz{ Ssa8Ћ˄HI8F 73_^[]688s˄8F 7_^3[]H%$@ϋ;7I 8@$$@W3W $D@W777B˄E u 6H)$l@w} OjV貶kE>ϋ+șMȋǙ+ME;EL;Lu vOjVI;Q FQF666A˄E { CH{ Cp#55A묀{ CuyHCxH @$@;;;/@;\;[4@낋;+/UXUN;@;@!3@@@@@@DB@@@@@+@s@@Dм@D@D@@@@BD@@@@DD@@@D@@@@D@@D @D @ @@ @5D'DJ@Dh@@h@h@.Dh@J@D@DDl@ Dɻ@@ɻ@ɻ@. Dɻ@ D D D@DY@7@Y@Y@BDY@@@dDg@U4SVWM3hMfJE38W40RJjoYYtFa|juԃau_PEԃ`w$/@M PMޒ_^[]h+IM Zލ͋u n>F hKhKhKj&eRj+^RjWRj#PRjIRj.BRj;Rj4Rj-Rj&RjRjRjRj RjRj Qu ISh\K5(dL 3AVjUjULDDDDDDFDxDD*DDr@y@@@@@@@@@@@@@@@DDD5DH@xDDDDDpDDDDD D D@DDGDPD@@@@DD@bD2D@PDDD/DDDD@D@@]@1@d@+DDD]DqD#DDk@DD?DRDhD~DDDD@@D$@D@H@@?DUTSVu WMI]CfNty]f5XfGXu;t6~ ZNZF ZSF #WZJZ3_^[]E@ vWEEEDE @ Ej@ EEPVuWU]ÅE@fxOVAE ؋EC] HfxNvEx V3ǀ~8E $2@}E A;|jjR؃ M(UE.Uu;~ OVN^VF S_VB $@Euf90tCQj]UB we$@Euf90t'QTjQxSXuSQxTXuS]b[~3w3ujz(UuU@D@n@n@@n@n@/D:D@D @~@~@@~@Dv@DUEX} u.}u4}u7}u=}uC} uI}$X3] jhXjjwXjhuXjhiXjh]XjjsTXUSVW} M3jCAZf9PvXpRLD_^[]USVWX] Uj BYf9HtSeEejPSRExKp~ uHNEP~ Fu;M@U BjYf9Hu _^[]M`FH8볋@8@ Pjr:XU0ESVu 3WM]x ]E1E};W ENEO EE;E'XO If;MMMW;EWwu @ EEf9EWjEPVWq}M]~u]4G;|u 3ۋ}SjQϾ t{MQMGfx@uEMDBME;WG}f9xu%B3ۉCM_^[]É]@ Pjk#WuMjzWUQQES] VPW3MU;sH@ Mpf3VfNt=fOt4fGt1fHt(f@tft CM;r3_^[] uOGU(U3MSE܋ىEEVu E@W]x }jNYf9HM>}AjOx }_f9x}jVjEPVQEjOZ@f9PE8@AM܉ EM܋0MUFu E@Nu~ tOU~ ubE|Z3~]}4F;3|}]jQ蕿YYt,eME_^[]Wj{U3Wj~UWhUUHUSى]VWIEu }UGfyFUldLEEElGfx3)W$]E=bL=bL}U5bLVS脵J@Aq%uu EEUEV8UEtREPS%t E VU}UUGfxNWfxA7}A@ EU}}t%pdLt 9UhpdLMAfxN/I3ۉ]M;E@4>Gf3t7fNt.fOtfGt"fHtf@thftfK]B;rVC}ЋY;_t]M봋}Ћ Mԋ?}܋>U}f f;>uӋMԃEMKuTuu E}]jPVWW@ff@TAfx3U}X~ Ful8t ~ Fuc8t~ FuZ8X~ FuMM ;H~R~ Fu?;HDFB~ Uu2M @;wX_^[]@0돋@0똋@0롋@0뮋@0뼋@0jhbXU VW\p蝒MEQMQP)x}tHEA_^]UDSVEWM]DuEPEEPVɿNEfxWU }ȋ2N3u ȉuĊ؋Ppu2t'u#@3f9puۋ tNHuхuD}Oŀ}u ]}t3F\EPMM߹_^[]IA냍GUTSVuWjMEQMEQVEEEaVMEUE uTuc2ۈ]W V}fxrY8iYDGfxAu _^[]y w$@t3ExH3EMuI;j -KfNFK fN f?~AfWf ME]4MSAMfxuf0|jL-Ѓ: HJHJ@ B 럍6s3ɉE Q,Et MtQPVg- uH-uE;HVj ,OfNFO fN f?oVfVf MEu 4EMEPM53ExH9uv.EVj8++EMFEFEN NPA肶EF(N Po`F0`\M貵M誵_^[]tQu@9E } UE UE 6SHTv;fxt B;r8uDfxuE 3s3lu3nHO3 I@:6DE6D_6D\@\@@\@\@\@t6DUQUSVWz3ɉMuu R_^[](9V$@u Q!_^[]u R-_^[]EPR"ƆD_^[]jEPRJ_^[]8e}TdT`_0tO ӳO˳W1)`Ɔe\_^[]u R_^[]e\SQRE B=_^[]u Rh_^[]u 3_^[]u Q_^[]EPR_^[]jEPRG_^[]u R>_^[]jEPR_^[]I=@:D.@.@@@o@@[@x@d@:D:D:Dy9D@9D9D9D9D9D9D@ :D@@9D:DJ:D@@@:Du:D:D:D:D:D:D1:D9DUS]VW3Ms3EEEE 2AfNfOfGfHIfAt-fRt'fSt!fTtfUtfVtfsS뚅uMEE83}EE9bL8bLlS5bL>@dLEYS`dL\dLEDdLEDdLIW]UK@S@S; Utff;u Ou3 f;@U}KkY;9]t$ff;uMu;]rsUABAyMA>}G} O,GU}KA;I}ڋ?v!$ff;KuA9ExM@AM@A`dLA\dLAG6=Fv%E'uQ}OUfxNYGxf5.TF 9T 0T'T]CHxfAIMEjPEBPSU赴xr}^EHEfxWGA E;t9~ ~GF EF PuE_^[]}pbL]@dLEP`dL\dLEDdLEDdLKPPE; tff;Nu3+E}MCApbLM@A pbL`dLA pbL\dLA5pbLFv%sUABAy M}AE@0O$ff;@3$F QEE3EEDu]@ EfxNDBMjU@ EEPEPWW_}؃/O]̋Å2MUAfxOQBUOE}|؋OC]fxNu~ 3ǀ~(2@}|A;|jjR> uMԅOE؃O}EEEOUfxN5K3UEEEDu@ EfxNDBMjU@ EEPEPSuȃQ]ÅWPMUAfxO;RBUQu|F]uKfxNwEx 3ǀ~1EI2@}|EA;|jjR˞ QMąQEȃ`QUbsCEeF;Uߋtff;uFKuF;r8]M}YpbLEX]pbL*ЉEsȋMދCpbLCpbL{uCE:CE;aU tff;u1NuE;s#MCpbLCpbL{u sr݋]M}YpbLEX]pbL?(d$ff;f;F F 8VEOfRqNǮ)$@EPV}Nu;V IAG G 8u7w WFlj}6Yv N"I t$@MbQ踛_^[] $@Q茛E3UZUOAOjjEPu8]3"uj{wLujzmLML3iMsL?@?ADOAD_ADoAD @x@x@ADx@BD$BD7BDcBDcBDMBD8@I@I@ADI@ADADADADADADUQESVu W3EH@Gt,Ht7QBuEB3_^[Y]OGUUSVuW:v ]fxG~G3EEȉ@G|GTHt7PAօ2]u G9}F EEE9Fjy؃ECPNFWF}NFPtMEPu,P]M;t5UBfx@OA;OME9}BM}uf3_^[]s3ɉF  Q؃FO^ OAGAYO3SV艮U8UVD$HM D$ D$$AD$(Wt$8@ D$ddL|$;=hdLXOpWȉD$xΊ@ D$ D$ t$ PuD$,u PuVOWp?L$ ;H"OWp&L$ ;H O}G HD1΀y (@y A@x NwN )F,F  Gt$L$@0荘|$uPHp D$$P օpND$ 3D$ H9t$(v-D$$HT$8D$<8LGD$ =bLT$@8aG=bLjGbLSW\$8̈́^Gj t$L* d3FF Q 3fj F ;t;N G_^C9FGFEP76! \$< D$HjF t$@G ~FF3V|$\$D$ CD$8@lj\$|$DD$ ;_I;C\$,2D$@7fxC} Gfx3t2ۋD$Ht$d;-j L$`FL$pt$d譔D$8D$|D$p9D$T2j~ D$pFPL$TT$PD$PD$(4AۉL$X\$ECtPWGD$(t$Ft$HfxAT$$L$;Gfx@;CB;0CЋD$(T$$xfx@uFt$D$0\$D@D$0;C0\$,D$Hs D$H3ɉD$h QqD$`t$`t$dD$8s D$83ɉD$X Q%T$Tt$P\$`4tF;r\$0xL$P| ;Gv|y?A@z3u V+&H~fKA$AD$PPD$$PVjND$ fx;KD$kPD$TPD$(PVjËF F 8+KV2D$X$c? WL?$WLP#tbjjjj$Pօj |Ht!$|;15K$PH$PH뀋D$@I->jH5RLft$ t$ |HD$P2G~GFHGFHD$Lt$GL$<]D$f\$LPL$@gL$L$THD$Pj 9PGYtL$3_F ^]UQQEV@|QQ$bEu ]yE3F ^]USVWًM hHzuFx Ej8Y7F0%xhv7PEu~E_F 3^[]Uu uj>]UEVW@xPWLu u>3_F ^]USVuW߉}F}}}HwD~C~C~C~C~v FH w؃~v FHuwuVuuJu2SWXwPPwP u t>_F 3^[]UVu3W~w8NjjP jjwPj5u wt>3_F ^]FHbU8SVu3WM]Fxσ CjXEsOE؋AE܋AEA M؉EEAEAEA EEtM؉E4EuZ}EPcyB~wFNPEP #vPu s3>@F M3_^[]M3뜋FHaUSVu3Wj_~kB~w%SWu 2s>3_F ^[]FuUhVuMVx (BSWj3E~_v-BEx IBȈ]GuFy 6B~vprF uMEPV]]E} BFuE8]BMIrE8]BVP׍MYYM EPs_[3^]j_XQUDd$SVWMq3ɉL$L$0OEj*@pNu|$ ut~ Aj[qND$ AD$$AD$(A D$,D$ PL$4Xt L$ 1zAD$0PvtA|$ E@0pFL$ 0FVD$PD$PD$PD$PD$$PD$4P=؍L$ 71@AT$L$ T$TA|$ ]AD$]A|$^A|$_A3 ЉT$RA@3ۅAj(;AeY\D$D$PM L$HD$0PWMA0|ovvWt$L$Q05RLHKAL$00_^3[]d$LUVW}3dAtAGM 0sM Xj_3^]USVWj|H$DŽ$@PHM ?i3ۋjCSVf$ۄ$yHKd$lD$dj_jSPV\$t$ eL$Xn߬$SSD$@P\$D$ IJd$LV|$T\$HdL$8n߬$jS$P\$D$ IJ$V$ݜ$dL$x[n߬$WSD$ P\$D$ IJd$,V|$4\$(LdL$ n߬$jSD$0P\$D$ IJd$<V|$D\$8dL$(m߬$\$D$ IJD$Hd$PjSPV\$X|$dcL$Hm߬$jSD$pP\$D$ IJd$|V$\$xcL$him_^3[]UQQVuW~vFHoHt)Ht&H`?FM 0qM g_3^]u VcUVuW~FHdoIJQQ$xFYY]oHJF?oMQQIJ$)<u} YY]lEG ~>_3^]3xUQQEV@%oQQ$9u ]3lE3F ^]UVW}Gn~7HGlnjΉdž_3^]j|HUS]L$VWh{LVYPL$\$V|YPL$@$C0j^L$D IL$`7-h(+IL$0mPQD$0PL$h-L$,x+SL$d..3D$,IG|$XΉt$t$0t$4t$8L$D$T9s"QD$0PVL$lT, D$0L$0@D$+PQSL$(LLL$ΉL$VKj%Yf9uFPKj%Yf9/VKj\Yf9 =D$;D$Tt$@L$HVSD$ID$HL$DHPwKi=)=EtGtX=d =w$EL$@ lQQ$t$LWWL$ Mt$;s;s|zM D$P>kL$,hL$`+L$`)L$D)D$@uPYt$<YD$\uPYWYL$)_^3[]Q;jVSL$(JtUS]VWC0hFpCHkXExv @H|kMF;KxGxG+;?E@0JhWSvMQHM EP6jM(_^3[]뵋+USVL$L$`WQ*}G0gG^pgN3L$D$r&GHjL$D$_;QHQL$lD$F*P;SL$h*;L$,vE;t<=\$83D$hH|$ D$$D$cFD$Cp*cFD$Cpcd${FD$:Qt$L$8%\$S:L$4g&sL$$DD$ Pt$L$8t$$!M D$ PdjVHL$ ^#L$0%L$0L#_^3[]UdS]VL$8WC0UbFD$C0@bFxCp-bFD$ CpbFL$@W@D$CE33ӊˉT$4FL$xr)@HdЉT$43@#ЈL$T$4D$9+J:I\$~_t$D$ WfЉT$_^3[]USVuWV.~3ۋCS}9Fp]jv&9_^3[]UQSVW13NMx@>+‹SS0uYYx~ {M;~;_^[]sUVWO@uFP[bFPWEF(F,v0"F4,F8PEFH<FL@FPHt FTQΉ_^]U8VWjX:YNPaPNDN8F(F,F0F4,P^D<MȉFH@FLHFPFT*PO@yM\M\_^]3JUQS3VuӋPH 4tI TL@f9Xu8!t t^3[Y]UhSVWM93EhHEMEԃE؉E܉EE}HE9]u jHYSE@f;E@Ef6fx3$70M*CE3t"uԋ؋ US uG;ru ]E;6EPMSfxAuH}uBA3ɋ@fGGjH[f;Ë]0f;Ef;E*GË}E@E@f;EAjH_f9x}H6jHY@f;CjYf9HB6]SuMBEEHEEEuEDTLEEP}CMMME_^[]}E }jH[f;Ë]k5f;E*IxAjR5MUMSVWo73B3RBUa1؅J TLKf9puփ8 t8+ũ8+853EDfx40M@uy>DTLBuTCDfxGuQuEPE}PEPSxUPDTL#A3MC_^[]Vh4Vji4US]VuWUE6EÉEDžDžEDžEEEDž4U MoZ}E-4;=ERCP 4G _EP3}Et 3G"w0W$uuG0G&u ȉ$EEt@M t uvuċu3333G 3G @3}uE0DJM 3EG 3E3EG&G"uЍWUtE xB|E W3\ M3XC3TDž,33H)3L3`3w dDžhEEE3pE<@D@%22Džlpp2Dž}O3VUUUm@VUUU ‰EG f23u VUUUE‰t7G +ЍF;;F }jG @}UEąJ@@MG @:|UI}]3Ëw u~9u9u4U9u]u.9uu)MątAt+;A(=MjjPjUURtDžEEDž(8Mh6/6q7}]7Eu7ƙ+‹Ƌ]+;7}E+xE+xCEt 7_^[];&ʸMȄ UU;UrE;;s Uf;M2;\f9 SU;rDwEu쉝 0@MwDžu艝0+ƒ=}< B;Ef;'4;sff;tB;r3} 5M} t5;sSI?53Und]U3 hTJ3fndUPSڋ]ЉEVWZ5uEENPM;FU@E;F J5 EE SA$RAC+}f;$Af;A3ɉM؃}rEf;EEf;EEf;E[Ef;EJEf;E9Ef;E(f;xAf9 ]U];E _^[]ÁPD~pCfȉM9U)QM9M4~M;|E;F|} U{Ǻ%=OTEaTwF< F<8;`EU]OMԍ< }y=% ;~=M ;=FN +EԋUM+NxF L9} GE }M_E;F|ɓ}MEt%=I‹U` K%yHȀ@C M`UJ IC BJBJ;K@;t ;sK3U]}RfC]f#f;_F|U+;f Of]ЉUf;SUԍE;FN UEċDE̋F+Eԍ EȋE؋EE+FxIEM@PuVu pTJuCЃ i_^[]_^3[]ÍOi\TJPTJEU}uE;}]Ѓ__M_};ULu'E@PuVu u}2}d$U;U2N|;Δ} u(V}u܍FPQH U%=E <EB@UPuӋVu u~^b TA$TAB]ЃUEPTJM\TJEME.$EM;F|.L%=KKʸM؄ }EӋ}@PuVu u $Cf}5ME싆EԋE@PuVu pTJuCЃ dרCCE쉆f;wEԉu@3tMEHEE@E;E+5Eo8}t>13O3*V3KA7IAMRAnDD:D.DDDcDʒD1D-DURAD)MADxDMD"DD?>@ABC>@ABCRRRRRDEFGHIJKLMNOPQ|PADUVW}Nt`~tZ?tUV9Nv$F4v F,P7R6VF(F Hf,} t ;PF(_^]3ULM3EESV WQaE3fjOu] 3u}}K 3ɉ{fE@0TK(TK TKu;dyf:\r;Wyf:$G};DQK EC9CDKUfHC3ҋKfHF;{u؉u3EE3ɉE̺ Q5E3ɉEfj ȃMEMԋP;+ljE Ѭ}E;XUn uW?u4]uuuV_^[]3uIAAA3ɉMV`UhSVWu~~}3jPEE%} uEMM33ۉU]d$}#~~ N;v$F4v F,PRVQ6NȃN(F PF,8;x}}UF E+*N;;M؋C9EE4MV]ЋHPu薵Ẽ 3f uE;tCO G@9GOPu̍HPF_ O3ҋfHEPuEE;ڭ]tCO G@9G+OPuHP_ O3ҋfHUM U?jjM#]$Pu&EԋE̅t P聴E3ɺ Q3f XEu ~,1FM+PSVTE̋P,!MME_^[] E+K3USVW39~tY~tSM jEPM~:9~(~)ߋF D+MM EEPMG[;~(|ًF(_^[] 3V3F0(FFFF F$F(F,F4 ^SV~ u/3ۋΉ^ ^^^$^(^,"^F0(F4 ^[v YUQSVW]Sȅt9A~$FAFI3jZ Q]F 3Y_^[]V0EQPEPQ e Ft9MQYN~$WjЉFd@kPvvSu넋EUVuu$FFF^]VWcL7u_^Ã~t ~t vhTJY~t vhTJYVYdL|UVWu dL4cL>j YYtJdL4cLuΉ~#E FEFEFdLj@@Y_dL^]3USVWu8ؾcL>t9_tdL|3Ut_^[]UEVW3P8Ҹ~ >k!F;|_^]Wj@cL3Y!dL_U}SV1Wt%=gj_j [;;t i3_^[]3釫Vq;ru tff;u Nu^2^SVWыr;wvwދtff;uKu;wff;s_^[2UV>t6#Yj襯YtM^]3UN$N4NljdžH٭Yt 8_^ËaVW39~wf_^ËF4YF$G;~sVHvY^UQEPhj3PPPutH]UV6u&E0jj 6Ht} ^]2VW?t7~YA6+ O_^lV&NyUJ?4_jqYt hHHF^3VW3DF|_^jAZ @JuUeSVW}3ۋ!ԫ>ERCPȫF F$N&F"FNEF N0MuE3Pj MPTX@j \EjPFP UQMPa3ɃA;MEjvЋP E۪9]u~MjLlTJ3Yths @3s,~j 9}t*FEPFPWE ~;NF(_^[]ÍFWP!]_KgKΉ~(U]UE Me SMVErW3}f;tf;tf;t IG}Ӌʁ"0eA$dAG}}tfFf#f;u뷋EyUljEjwYf;tQ_^[]Ãpv" vCG}pTJjw_4FF4Ff9>t}^;}r3!}}EeA$eAuMu u sjw}_F4Ff9>uFjZf;tjZf;tpTJ4Fjw_%jscA EdAcAHEcAcAEEdA EWEEcA'E~EEdA[dA EdA*EdAdA  cAcA7EUQSVW}ىU3pTJ C=======2='=}tR=tK=t:=t3UѩVȩ^t%t t3_^[]ËE @P۩u өCCf;w3@URMME SV3W]3ɉ}BMUЋuM}܅2EDž00DJDž40EJDž80FJDž}E~ ӫ#;pjY%pΫM3ҍ@|ʉDP@@XljUtp`d\UUDžlDžhHf9t @Af9uOULˍwUEȉE܍@E踃f@EP0UPREԉxPE䉕TPE]PEPRRRREPEPUu4MЉMЁQ9u!d`4E8VlTJYs3ERCPECEC E؉CEC3CjXfC"fdfC$f`fC&3C(C,s0s4ptuupxC"C\C$K&ȋ@P`uuuuT;u }49T$,t|$}\$,\$\$L$L$0xL$$T$(9T$u L$T$G@oU3ɉMMh|MĉdMMMSыȉE EM Vu W3#E6jM؉MMMY]X\uUMMMMԉtDž(DžDžDž+Dž{DžP0Dž)Džx9Dž<DžRDž$'Dž-DžDžDžDž DžDžDžDžnDžoDžpDžqDžsDž>}܅* E(U,H<@H8tr;lX;+ȸ+; M,UtD\;vC+ƒPRQ U \+ыuډMSM(9A \]M(U,X}Űڃ]Bj*X;j+X;j?X;j{X;39EȋE@)Uj?X;q3+$HvHH ? }Mf tǺ#=cj^}UẺUtQtMϺ#º;s` KE`UJS/JD UE̋MjXjYf։Utˍ ɍZfUEj Yf;j Yf;U(Mԃ2EEEE؋EME;]]CEBh tEuUjXucǃ[HH#H"HEM],EMԉEMEME0t+X+;  E_^[]Í~HjC YjH, YEj:E[f;j.Yf;j=Yf;jZj\YjE3_Eu]; u ^ j]Y;}3j XPUR0UP}}}UUU袸u 9}tù#;U,t E;}[j\X;K U 3j\_f9~G j X;pj X;e}ąu j-Xf9FEjY;;EUSSu(u̍U䍍0# M}ȉMu}EċUj[u]܅.]E;}wE]ԃQu]]]؋]u]lu3];jnYfjX؃},uc j XP0PS菗 j X؉]@EMEMMM؋MMM;;ً]EtEE(p3ۉuSu̍Mp@u U 9 pfpMى}f oM(3ۋEjEQ UZ]j*u_E]f;8j?_f;E(U@@f@@fBEEu]jR_E(@XxX# f|UUЋE,zhr@3؉}|#;;z3Pu(lu PTP`P,PE$UPuEuQu MP4E(HX;Duj}Y;| ; ;;`luj)Zf9U,UU;tDUdU؋UUUUUԉUk:]j]Xf9F?}3ЋE U}MuEEEEԋE؉EEE‰M+E3EȅNj+[f;j?[f;y ]EjuYf9~f;f;f;zf;mf;-f;me ;} Cf]jZfuډ]3}}(3EE GhU)уjZu>ǃ:l<vHHj Y++j*Y+t3j)[EȍMЉUf;t5jZj:Xf;t$uidE >f;uԋUЋE U#ЉUf9}}(]jYG;PM # 3#tỦ3E=f;f;yf;lrcf;VtMj}Xf;@ f;4E3ҋ؉U+]U亇f;ʋU]f;̩Muu(u;@U3fMyM qPQVr] jX؉]MEMufuO}5],:O3U]܅Ѭ3]jZCbwjXj\Xuf9jXAfu j]_f;}}t#;u}uj\X;[M ;{jXj EX;j X;E(WSPp]jYj f Yf fރ}]0顸]|+ʍG;n]GM,jZډjxXfffUԃuUԋME}]EEjMYj0}#_ ljU]fjvu}j4_ًMjZf;ϭjZf;íMEMEEU}}׭E!Myf}ujX}t f]؉]u7~MԃuGwMԋEEEE؋EjEXM;jX;nsj^;jX;MLjX;A;9jX;B]GjY;#Ӄ}U?jf;Z6Nf99jHY/ӷu](pu̍Ms@u U 3Ƀ9  pu]ry,T ljlTME؉]$Uu֠Fѣ؉]]UMH\U( Ej[/jE[uj 3Y錿j E 8uUSVW}UM;wωME3ۋuu%ExMu;w1C+Ƌ؉]]֋F;vu}]Ew;?_^[]ËȉE|UVuWt9NIBf;t؍E_^]3U$U܋M3SV0B 3W#ʉE~UMt%=&t\j0XE;sE uPE0E܉8_^[]ÃzwߍWE{USJE~뼋ۃ uE맍KwUSVWpTJ3҉}B A;jw[>3jY}uf;@f;f;f;sAxf;V@f;LAzf;@@f;6Asf;@f;Auf;@f;Aqf;@f;Awf;G= A$A3_^[]ÍN" w3@ŃAJEKEJEJE΃A|JEA(KEKE       |~vt}>ÅtpTJ AUQQSVu W}UȅF_^[]UQQSVWftvj^uEfufptx;ttU|$Za]=`Oa+pTJ AtB7vfu3_^[]fAf#ºf;uكA AA A묋U(SVWjpEZj_MAf@Dffnfof;;]8]x[TtpTJ4FtA7wfFf#f;qi-HHHHHHu`auf;y~"jEYf;wUE؋PEpMɃM܍MPQutEw $AjjXfjpZjE__^[]f}j!Yf+ff(E؋PEppYYj!Yf;tkf#tef%t_f'tY3ɉM܅tPM؋Qur xEjlhZFf;t f;Eph33Ajk4jm-AAڇAڇAAAAAUUdLtVjEK]K'AdLKKKKKKh%IK$)GKKKKKK4!IKiAKKKKKKIK:G KKKKK K%I,K)G0K4K8KGK KKKKKI(K>G,K0K4K8KGPKTKXK\K`KdK$IpK9*GtKxK|KKKK#IKHKKKKKK#IKHKKKKKK IKMHKKKKKK %IKZ*GKK KKKK@%I$K*G(K,K0K4K8KY_^[@]3IAAfA UVWy*N 膛UF,V M _^H0]y AuË@8VW~ Y~uNy8tQP~F _^F UV~ YWj@Ytu4FG8~_^]3VN ٚҚV8Y^UVuWVgQFO GFGFGF aP/F0G0_^]33@A QQQQA,Q Q(Q0UV~ Yj;YtM FBV^]3y AuË@VW XuGPpaYwG _^G AuVXUQQIMX]UQSL3ɉMV@ǀSLI SL SL SL SLTSLSLwhIo|SL^]Wx@DŽ8xIeO|ug_V7XVNhTYN4^VN$9YN1YN^(YVNvNxvN$pv^U$E3S3ۉUVCUW9PWEM} uEME+E#Wqyj+Yj^f;Yj!ZWf;Wf;Wf;EWWGΉ}4yu} {Wj@MnyEPEPEPj}WtOu4JJ/.YYtFc|cOWIJu"@IJMX'_^[]2UMSVm|u26M xftuf;Et MPw׳f}t^[]SV5H3WjXSGfG____j[G SjG)ShG&ShG'SjG(SjG$ֈG%_^[USىMV3WA}3҉MsEf;f;f;f;=B$"Buu RV 3ҋM]jwCCX]f9q_^[]f>pWN"tj +[BKu3 W‰E3҅tb3뮃VWjw_5VVO돃WjYMZ9Wj$XjXIBBZEZEZE[EZE1[EZEZEBBZEmYEYEBvYEYE BYEB YE}BB=ZEBBBXEB#YEYYEB     UQQSVMW>;w:EE3ۋCËM V}QWF_^[]ÃeVWHȿ+3;w;w_^;vnucu33@StHt3@3o3ɄU(VEPPh1`HEt3fPtv^]VV&Ytf|F\u3fLF^UVuWVzFGFGFGFGF G _^]0dLt8dLÃ8dL0dLUEVP0Htm]E5IJ^]UQSVW3ڋׅu ttSE=ERCPUA t1}u$BAu 3_^[]Ëu 0DJjVA%z'֋Aыu UA A$A&A"A 7V /V 'VAVj.Vj'VBB`BB8\Ez\E\EBBB"\ErBBBB\E\EBBS\E`\E\E\E\E]EBVW3I9~wvfY_^ËF4YF$G;~sUVWhP1 HύPt_^]UVWF 9Ft-jYtRU JONFtkPWYVY_^UVW3j~~Yt u >_^]UUBABAB A BABABABA]VW3$I9~#TvfY_^V3VQHHT^UVPh4HPEr^]URLSVWEhV:=YPa; YYSMPgEPw9Puh(IV> E}SMO}V@YtSV<YP:YY_^[]h@UQQVWE3EttGP+Yug3S]O+t\HHtTf9Gt2GP1Yt!k E WJ3f9Ou΋ ME [_^]2넃MA롡dLuVLSVًWV{ !Y;R2_^[VWN8MNMNt QnfF SRtRHHR NtQvfVFY_^VfNfFjN8j^VN\MNTMVvY^VNjNj^IItVq8Q΅u^ÃLU]`UJ t4Hk0ЋB tBt BPPPPIt׸EU3ɋBtJ̉MB$t?B t uҋUZ0ҋUZ$B(tҋMQAU ҋUB9et EJ t Buba]E]U]NaUNaUJ t+0]BtBItۋURNaRPUB t u$XZ]]U]H51LU HuW ;+t3Ʌ M~B+t3Ʌ My~B+t3Ʌ MWNB+t3 E3Ʌ1F;BtB+t M ~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BtB+t My~ B +t3Ʌ MW~ B +t3Ʌ M5N B +t3 E3ɅF ;B tB +t M~ B +t3Ʌ M~B+t3Ʌ MNB+t3 E3Ʌ~F;BB~+t MR~B+t3Ʌ M0~B+t3Ʌ MNB+t3 E3ɅF;BtB+t M~B+t3Ʌ M~B+t3Ʌ M}NB+t3 E3ɅWF;BtB+t M0~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BtB+t M~B+t3Ʌ M}~B+t3Ʌ M[NB+t3 E3Ʌ5j Y+;_Ӄ$|+BF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅyF;BB+t3Ʌ ML~B+t3Ʌ M*~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MqNB+t3 E3ɅKF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BB~+t3Ʌ M~B+t3Ʌ Md~B+t3Ʌ MBNB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BtuB+t3Ʌ Mu`~B+t3Ʌ MuB~B+t3Ʌ Mu$NB+t3 E3Ʌu3ɋ_ F;BtuB+t3Ʌ Mu~B+t3Ʌ Mu~B+t3Ʌ MuNB+t3 E3ɅqF;BB+t3Ʌ MD~B+t3Ʌ M"~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MiNB+t3 E3ɅCF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M]~B+t3Ʌ M;NB+t3 E3ɅF;BB~+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3Ʌ}F;BB+t3Ʌ MP~B+t3Ʌ M.~B+t3Ʌ M NB+t3 E3ɅBN+3 EF;BB+t3Ʌ M~B+t3Ʌ Mt~B+t3Ʌ MRNB+t3 E3Ʌ,F;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ Mh~B+t3Ʌ MF~B+t3Ʌ M$NB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅgF;BB+t3Ʌ M:~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BB~+t3Ʌ MB~+t3Ʌ MB~+t3Ʌ M^BN+t3 E3Ʌ8F;BB+t3Ʌ M ~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅfFf;BEF;BB~+t3Ʌ M`~B+t3Ʌ M>~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3Ʌ_F;BB+t3Ʌ M2~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ My~B+t3Ʌ MWNB+t3 E3Ʌ1F;BB~+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3ɅF;BB+t3Ʌ Ml~B+t3Ʌ MJ~B+t3Ʌ M(NB+t3 E3ɅF;BB+t3Ʌ M~B+t3Ʌ M~B+t3Ʌ MNB+t3 E3Ʌk~B+t3Ʌ MIB~+S3Ʌ M8M1+t3EqB+t3EqB+t3EIB+t3 EUu  +t3EujJF+t3EuLJF띋Uu  +t3Eu JFnEE ]3^[]ËB!B%B*BB !BP%B)BlBs B$B(BBB!$BW(B=BEB#B'BBB"B)'BBB\"B&BxBB!B%BUEffu+EH]Vjj [YYVdHPRLLRLujX^Ã&3^j hОK\eeu#YuE \ËuUQSV5PSd[YYt1PdHPRLudHKQdHLRLE3_^[]UuYH]U}t-uj52LxHuV]@HP]Y^]UE3ɋf9tf9 uVu +f 2vfu^]UEU V+ f Rfu^]̋T$ L$tD$%1Ls L$ W|$]T$ |%$Ko]Wr1كt +шuʃtt uD$_ËD$UVMF ufW k~WlOhN;4KtKGpuaF_;KtNKApu/eFNApuApF  AF^]U=(2LuuUu\^]ËM tSVWjA_jZ+[ f;r f;w f;r f;w ftf;t_^+[]ju u ]UMSVu]tu ur[]EWuBjAYjZ+Z3f;r f;w f;r f;w ft:f;t3MQPM[QPvftf;t+_}^[tMap‹]UQEPh-IjlHth-IuHtuЋ]UuYuhHUpuqYhjjjM jjj> U=@Ith@IrYt u@IYshHhHYYuChB$HhHv=HRLYYthHRLrYt jjjHRL3]Ujju ]VjdHV/V[VRVsVtsVu^lUE SVu3+ƃ9u W#vtЃC;r_^[]UVu3utу;u r^]jiYjNkYjhKVjiYe=1L1LE1L} 5PRL5:u t}rjWjQuU~ t3fˋftWf/tf\t f.uNfu܉Mt,Et!+9EPWjuM Et3ftE;rAUt+9E v\PWjRΎUE$tA+9u(v?VSjP讎)Ut+9u vVWjR菎E$t3f3iE$3ۋM t }v3f1Mt }v3f1t } v3f t }(v3fHuj^0J uj"Y_^[]W|$n$L$Wtt=u~Ѓ3ƒtAt#ttt͍y yyyL$ ttfu~Ѓ3‹tt4t'ttljD$_fD$G_fD$_ÈD$_UQkUMEuH3SVW} ft0ftf;t 0fu3f9t fu3f9t>3ҋftUf;Ut fu3f9u f9u3fE_H+#^[]UMu/FHjX]á:L3]jhPKCe} @t0t(t ttEuuE ;5ALsyE ރ9LDtXVXYeE 9LDt WVNYYRE }E !u}V讏Y#E G-CUSVuW<9LL7%ED7$ЋE =@tY=tI=t*=t#=uPɀL7 9LD1$$ D1$4ɀL7 9LD1$$ L7ɀL79Ld0$}_^[u]ҁ@]UEu3DF]Ë@]UQQM SVWt]tuuCF3_^[]Ã}t3;w֋F tNMV t6FEt,;sÉ]Pu6E )F+E];r^tVxYMÅt 3+‰E]PuVYP莐 tQM;wU+;r=M(EVPeYYt(EKNM3AM-EN +3ҋu j hpK@e} t$}t3uuBE3@Vf#YeVuu uK}E ȋu}V#Yj hK@3ۉ]3}uBD39E t܉}W"Y!]G @uqWYЃtt9LK@$u)tt9LKB$tAD]u%W]EPSu W؉]WV]E]?Ë]}W"YUVuu VY/V,YtF @tVPYY3^]USVu3ۋF $<uBF t9W>+~~.WvVyYP ;uF yF N _NÃf^[]j[Yj hKJ>3}uu W;Y$V@!Y}VY}EQ>Ëu}V!YjhПK=3}!}jPY!}3]u;5DRL@RLt]@ tWPV!YYE@RL@ t0uPYtG}u@ tPjYu E܃e F녋]}u@RL4V!YYEtEn=Ë]}jQYUf9EVu Mmu싆uMAfwf jf9Us(uaYEYu*ȋMQjMQRP迢u EE}^tMap]UjuBYY]UMSWu ];s`Myt~EPjSooM Xt} tE`p}tMapExt~-ÍMEQPuYYtEjE]EY=3A*]EEUjpjRQMQWEP̣$u8E{E`pou}Et%MapUE Ѐ}tMap_[]U=(2LuMAw ]juYY]UfMff#f;u-EQQ$AyYYHtHt Ht3@]jjX]ø]ɁfuE u}tɃᐍ]EDz ɃA@]Ɂ]UQQVWWh?]~YYM#f;ugEQQ$~xYYHtIHt8EVHt HJ\$$jjxHQQ$jv{7WVE'WVEE %EEWVEEYY_^]̃=AL\$D$%=u<$f$ffd$uZ=ALt2\$D$%=u<$f$ffd$uš$T$D$ ÍT$ xP<$f<$t4T$IL$S߰u=9Li K餱=9LL K>ZÍT$ذD$uA3D$u33% D$uÍT$蛰D$ %=u T$uutQ$\$qYatBD$ % D$؋D$% D$t=fl$D$t-{ItA:1-0|Iٱu KٛuUQQEPtHME*jh!NbPQH|=o@vЋMtQ]Uj@u u ]j hK63ɉM3}u8;33] t3f9 t#uu U83Ef9u >8jEPhPK谵 VuSW}E6Ëu}VHYUVuWu7]: EF t9VVVoP腶y~t vfYf _^]j hKN5}3uu]79h5F @tf V!YeV?Y}ENju}VeYU}ME SVWMEt]tu6c93_^[]Ëut 3u;v$} tu jQ` t3u;w}F tNMF t?FEt5;sÉ]M;P6QuַE)F+a;rht"3ҁv+w;EwePuVYP tj+E)EM'V4YtUMt$UBKUIMNME} tu ju) i5"N +3ҋuyN Uuuu ju]j h8K23}9}t19}t,uu-} tu Wu 4r732VY}Vuuu u}E Ƌu}VY̋T$L$u@:u2t&:au)t:Aut:auuҋ3Ët:uttf:u΄t:auńtUVuwoSW2Lu3JjJhV2LYYt3AQjPpHu&j [99Lt V%Yu33_[VY3 3^]UM E]UVuF uW3nS]F WuV} 3Y} V8F YyF ttuFSWVYP 3Ƀ_[A^]j hXK0e3uu2;5<}t tuVzYeWu V }E0Ëu}VYU(cPK3ʼnEW}u.24DSVW3ۋY9_}_jSV Ƌ9LG T$u+G7+m 9L9\09Xu ]S9Lt,t(貽9L;t(;T,SRhR4HSQ踻 l;^t3O;s*< uB;sA8 u KAuэ+1r9LDt: uGB;ru .u/9Xu +ppj9L[DjS衺 ;u?BƋ+J;B#vB8 uF@C;rB TSQH y\;w@ t @ tp9LDtFu+ƀu^[M3_i]j hxK,e3uu.(1%VxYeV,Y}E,Ëu}VYUS]V3uI.0hWhj*YYt=<plW!=EYYWjWh]Bu _TVGXhHwu"@HWYtV-Y_^[]VxHtҋj hK+0<epXPTY MEQPPrYYËeuV<t~t v\HV;YjpHU\:P?Yu!uG:P?YYu(@HPpHMQATBTAXBXAB:>̃=ALtn\$D$%=u<$f$ffd$uA=ALt<\$D$%=u<$f$ffd$uɺ |I鉿 |I鳽̃=AL\$D$%=u<$f$ffd$uUɿ=ALt2\$D$%=u<$f$ffd$uu $蒢 ÍT$=R<$tLD$ f<$t-h|It^uA=9L\ KYuԩu|$u%t-0|I"訡uŃ|$u-{I=9L KZÃ=AL\$D$%=u<$f$ffd$uU=ALt2\$D$%=u<$f$ffd$u $B ÍT$R<$t6f<$t-h|I=9L  0K虠&u|$u-:|It뻸=9L֠ 0KߟZ̃=AL\$D$%=u<$f$ffd$uU=ALt2\$D$%=u<$f$ffd$ue $" ÍT$͟R<$tmf<$t艟=?s-=9L @Kw8D$ % D$u'tBu|$u-0|I=9L @K蓞Z̃=AL\$D$%=u<$f$ffd$uU=ALt2\$D$%=u<$f$ffd$uu $Ҟ ÍT$}R<$tmf<$t9=?s+=9L PK非w:D$ % D$u)-:|Itu|$u-0|I=9L: PKCZ̃=AL\$D$%=u<$f$ffd$uU=ALt2\$D$%=u<$f$ffd$u $肝 ÍT$-R<$tTf<$t-h|Iz؃=9LZ `KW-j|Iz軜u|$u-0|I=9L `K Z̃=AL\$D$%=u<$f$ffd$uU)=ALt2\$D$%=u<$f$ffd$u $R ÍT$R<$tPf<$t-h|Iz=9L, pK)-j|Iz菛u|$u-0|I=9Lכ pKZ̃=AL\$D$%=u<$f$ffd$uU=ALt2\$D$%=u<$f$ffd$uU $" ÍT$͚R<$tPf<$t-h|Iz=9L K-j|Iz_u|$u-0|I=9L K谙Z̺.IA.I鼴z̃ $= ÍT$R<$D$ tQf<$t蠙u=9L Ku,u%|$uu"u|$u%t-0|I=9L K还Z̃=ALS\$D$%=u<$f$ffd$"~D$f(p.If(f(fs4f~fT.IffʩuL=|}f=2 fL$D$f.{$T$ ԃT$T$$D$~D$ff(f= |!=2 fT`.I\fL$D$f.IfV.IfT.If\$D$̃=AL\$D$%=u<$f$ffd$~D$f(.If(f(fs4f~fT.IffʩtL= |}f=2  fL$D$f.{$T$ ԃT$T$$D$~D$ff(f=|%=2fT.IXfL$D$.If.IfT.If\$D$U SW3ۍ}j3]Y9Euj "E VutuC "uEBuu=?v EEEPSuEPEDt9MxEE@EEPSBEYYMx EPSBYY^_[]áDRLVj^u;}ƣDRLjP=@RLYYujV5DRL$@RLYYujX^3ҹK  R K}@RL3^=1Ltg5@RLS%@RLYøKUVuK;r"Kw+P/N Y F PdH^]UE}P/E YH ]ËE PdH]UEK;r=Kw` +P0Y]à PhH]UME }` AP0Y]à PhH]U} Eu yjj juuu P]UM Vuj^0 }SWw j^U3f@9Ew j"ދEj"^;w3҉EUtj-Xfy3@ډEMߋ3uUЋE vW0fAt;Mr;MM r3fW0 3ffff ;r3_[^]USV3W}]]]uj^0_^[]j$hW蝿u t9^|9s j^0jX9F| >o@wAEPYEPYEPY^|nvdE+ȍEPډMW]YYI9E<WY-E)EEPUWYYG VWbYY9Et-WYt"EEG +։U؋E+jjj YufVW$}3]WSuVu97j YufWSEHxQ LuEu}EHx-(uEuYE@x  d3_^[]ÃpHHtrHu?u3ju M3ҋ}]9q 4E 73Pt"M Pu73@+ME@Mu uujjdY} uuuutjjE@ u uujE@uu  EL MP 3@VVVVV$UV39utuuuV NME ;sBHSW}Xt* EE }E0FfIEKuߋM6)1_[1^]UM VW}1?v#S]j [؍B0f~?w[1fff ;r_^]UM9t!UVu W:ftf8 u_^]U0PK3ʼnEEUMEЋES] EÉUԉMVuuWtHt\XTlfBfEfBf@fEfB fEfBfEfBfEf3RfE3fEERWPR`t YЉU ЉE؃  A;vHUwet$RsEYt uU3u~RVWEۋ]Pj`tsЃJ~#]u;vff JuVY3@e_^[M3M]Ã>t3}3ʋ߃@f9 tʉ]]܃d'AtHtOMt"ah.IW_YYuEO MTHtHtHtHjBjb3FjmHtHte3FjHuh/IW YYuGEjpWUj'Xf;Fffu/u'HtHtHtHjAja3FjdhIt#HHtHHjYjyMԃy LPuu>v}ff ftz]>vrf fu[HtHt3FjS/HtHt 3FjM HtHtMuf%3FjIXVuSVuuPu t}f3UEMSVWu3EóE] }3fUu E䋐UÉEM]ۅۋ] tn]f%] tEfMEHME@9ut|f?#u3@PREPEPuPEPt MEUut3f+u:9uv3@ƋM3fu9Uw }"p}tMap_^[]UEt8uPaY]Ujjuuu u]UESVWft*} ftf;tfufu3_^[]jhK !jYMZf9@t33<@@PEu f9@u3ۃt@v 9@É]ujYujYeXyjY|H(BL1L yj蚳Y7yj 艳Yj軳YtPvY;VPjh@}u܅uVy.MEQPsRYYËeuu܃}uV:E U==Lu#u $hֲYY]WVt$L$|$ ;v;h%1Ls3Ʃu%$K%1Ls vs~vftcfoNvfo^0foF fon0v00fof: ffof: fGfof: fo 0}v foNvIfo^0foF fon0v00fof:ffof:fGfof:fo 0}vVfoNvfo^0foF fon0v00fof:ffof:fGfof:fo 0}v|ovfs vs~vfBur*$BǺr $,B$(B$Bt~t ~tKuҋA_^[]USVu3Wtf=Kt_FxtX9uTt9uP蔞YYF|t9uPvYYvxaVYYtD9u@-P5+P"+P =Kt9uPqYYjXE~Ktt8uP赝3讝YYEtGt 8uP葝YEHEuV{Y_^[]UUSVWJxttJ|ttjJ[yKt 9tyt ytKuҋ1N_^[]j hؠKte KNpt"~ltpluj Yj @ Ye54KFlP!YYuE뼋uj w YUW} t;Et4V0;t(W8YtV>Yu8KtVFY^3_]Ã=TRLujMYTRL3UE-t&t tHt3]á`/I]á\/I]áX/I]áT/I]UMjœ%$2LEu$2LH,u$2LHuE$2L@}tMap]US]VWh3sWV赛{3{ { K+7FIu9AJu_^[]U PK3ʼnESVuWPvH3ۿÈ@;rƅ Q ;s Ƅ @;vuSvPWPjSJSvWPWPWS8^@SvWPWPhS^$MtL tL A;rYjX+‰‰ w LA wH AA;rM_^3[1]j hK3u KOpt9wltwhuj }Yj Yuwhu;5Kt4tuKtVYKGh5Ku3@E둋uj YjhKL؉]j nY}E Flu4KFlvl6YEx3Guj Yj Y蜖Luc3hABKYtVhjYYt-V5KYYtjVYYHN3@^3^áKtP< KYjhK{8K954Kt*j rYeVh4KWYY4KEj YVWlKlK tЃ;r_^VWtKtK tЃ;r_^UVu<KuVqYuj臔Y4KdH^]VWKSttSLHS'Y K|[>t~u6LH K|_^jhKa=2LujhYY}39Ku\jHYuG 3Bj Y]9KuShV  4KV8YE 3@j ;YVWK02L~uj>h6  K|3_@^UE4KhH]U졠AL3PKtu]]%HU졤AL3PKut]H]U졨AL3PKut]H]U졬AL3PKu ut]H]UDEPHEtEj X]U조AL3PKt uu u]u uHH3@]UQV5 Ky%BL33PKut VMQЃzuF5 K3^]VWhp3IH5Hh3IW3PKh3IWAL3PKh3IWAL3PKh3IWAL3PKh3IWAL3PKh3IWAL3PKh3IWAL3PKh3IWAL3PKh4IWAL3PKh(4IWAL3PKh<4IWAL3PKh\4IWAL3PKht4IWAL3PKh4IWAL3PKh4IWAL3PKALh4IW3PKh4IWAL3PKh4IWAL3PKh 5IWAL3PKh,5IWAL3PKh@5IWAL3PKh\5IWAL3PKhp5IWAL3PKh5IWAL3PKh5IWAL3PKh5IWBL3PKh5IWBL3PKh5IWBL3PKh5IW BL3PKh5IWBL3PKh6IWBL3PKBLh6IW3PKh46IWBL3PK_ BL^UuH]Uu|H]Uu`HPH]UjHuH]jլYtjȬYu=3Luh1h'YYUM3; P6It @r3]ËT6I]UPK3ʼnEVuWVYySjNYj=Yu =3LAh?Ihh3Lˣ 3ۅ1hh3LSf5LHuh@IVh3L莣 h3Ln@YjWYYuEf-uf+u>EEu6WaYt E LjxYf;tjXYf;t E0jXEu%W&YujxYf;tjXYf;u~3uUEWYuHjAXf;wfZv&jGYf;vE} u_tu3jYGf;w ɋME;sʋ}E;ru;Uv} Et>muu@ȃtw u-v%"Etj[Át7t_^[]Ujuu u ]U4Mu薃EM tSV3WtEt|$~hqUjS}]YYt>jW}~YYu}]Ef-uf+u ]EE$u0S"Ytj XEMjxYf;t jXYf;tjjXEu+SYujxYf;tjXYf;u ^]EʉEQPjjM5]]MEUS蟰YȉEuWjAXf;wfZv2jCYf;v*E]Mtu 3ҋ‹jYCf;w HɉM]E;Ms];}r/Uw;r&;u;}u3;Urw;MvM]tWPuuܲEjEX.u3ue˃twr3;w3҅uAr9wv2"t"t 3ҿEE3ҋMt1tEtM 3ɋ}tMԃap_^[]U=(2Ljuu uuhKj ]UQfEf;u3<f;sȡKHEPjEPjH#EM #]UVu WV躘YN u N @t "S3t^t}FN F ^F u*u ;t i@;u W輭YuV*YF tzV+ʉM BFHF~QRW) G N httNj 9LKA tjSSWh#ƒt%NE3@PE EPW7) ;] t N E[_^]UPK3ʼnEESVE Wu}3؉~A9u*.8t `p t3ɉf DžXDždDžiDžos jXB_f;wBI30BIlj $QB3؉ j Z+tFt9t/HHt   ˀj*Xf;u/Z ؉D k ƒ$ 3 j*Xf;u+k ƒƒItWhtHjlZ;twf9uj X 6u#f4uǃ3u#f2uǃrf; f;f;uxf;3DžPR; ƒd)S%t}AtHHtXHHtHHj XDž@Dž0j X ؉0u j X ؉tv u5K3ɋƉQPgYYt@@A;|XHHHHjDž tD3PptPPӬyDžf3ɍAt6pt/t+Dž3ɉ5KVՁYpegjiZ;tfnt'joZ;_Džy[MRE tfDž@Dž u ujgXf;uVDžJ;~=~7]WYt DžxG|PPxVP5-F Džjs{HHj'DžXxj0YQffDžU t@tGG@t Gȋ3O3@t;|;s߁uy3B~ uJ t=RPWQ09~N밋+FtEt>0tBUE @ @txtPu賤YYf;uE]ËE]UVu ~W}WuNu ?t_^]UVuW}EG @tu ME O&S] ~AEPEKWP[E E8u>*uPWj?>E ʃ>uE[_^]UMSur]C=wE苀XnÍMEQP,yYYtEjE]EY 3Ɉ]EAEjpEPQEPEjP膛u8EtE`p3E#E }tMap[]U$PK3ʼnEEM SVWE3EPVVVVQEMPEPp؃ t 4EPEP|YYuuuuuEU܋M+M:JM_r3^B[T]UPK3ʼnEEEE E3S3@VEÉ]W}u]]]]9E$u53UUE E  tf;Mt f;Mt uEE0E9 M $BAf;EwjX֋E$ɋ;ujX뺃+tIIt=3@jXMjX]3@EAf;EvE$ɋ;uj맃+t/-t*j0X;tCE~A3A;jsj iAjYf;9E$u;u jXuj0Xf;3@3@j0EXf;r+]f;Mws 0FGC f;s]3ۉuE$ɋ;%+T-K#3@EEuj0Xf;ȋEu Hf;MtEEf;Mr%f;Mws0FGH f;MsEu+-CE3@EAj Yf;jBEAf;Ewj +t"HHtjjXMj3@j0EX f;tAjYf;vEEEE<|EMOjAXMAf;E]j0Xf;h} t"BE+kHHu"MjXj Xj Y;pUh3@E%f;MwBk uP Mj0Xf;sMQj0X f;Mw  f;s MO?u HAO?tMMQPEP豫M yuEuuEu+uPI0@K`y Kރ`}3fEƃTUuk ʉMf9r}MMMy U΋3‰]%]ԉE#Љ]#]܍uf;If;@f;2?f;w]7fu$FEuu}u}u 3fEfuFAuu 9Yu9tjÍU_E}}~Xuč4FAEEEM]ȉMJ;Jr;Ms3@EJtfmOM}E@OE}uU܁}ԉUf~;x2E؋ UEҸ} UUffify]]EEtCM؋Mm EE MU܉E؉}ujۉU[t3fAf fEԋ}fEԺf;wu@Eփu4Eډ]փu fE޹]f;ufUF f@fE@EڋM@E֋MUf;r3]f9E]H%E:fE ufEċE؉EƉMfu 3f9EH%Ẻ]ȉ]ċUuEMċUƋu0ˋË3C#jˋË Ëjˋ[} EfG fWwM_^3[4]eBB&BkBֿB]ByBBB|BdB6B; PKuU}t]øoC(KxC$K,KyC0KmyC4KyC8Kt9tF FFujX GPlHEtLtHPHt=M%uF @ u F FjhF P FF @F@RLtXG=]3ɰj YjhKn3ۉ]uuP} ;5AL9LD8u  jVYe9LD8tuu V^  Ʊ }E (u}VYY蚱DZ JѯU?PK3ʼnEDEM V38W30@9uu3 u.!0[޳Ћ(S9L$\$tu+EШuӰ!0胳8D tjjjPp>8 YP($9LD2!3ɋ@l9P(<$9L4H9ItEht8ltw,8lu @ <6u4uǃ<3u2uǃ-(FDžjsHHkj'DžX|Qƅ0Dž^3 t@tGG@t GȋO@t;|;s߁uy3B;~Ћ uuJ t=RPWQ蒽09~N밋E+Ft6t>0t-N0!u5KI8t@u+Ɖ@t5t ƅ-t ƅ+ tƅ Dž++ uPWj QPPtuPWj0t}~yHPjE􉍄PP蜏u?9t7PEPtu(#QPV:x#tPWj tP@3Y_^[t apM3]聠kBsBBBHBUBBBUU B @tzt/JxMERPYYuE]ËE]UVu ~W}WuNu ?t_^]UVuW}EG @tu ME N&S] ~@EPEKWPIE E8u>*uPWj?-E ˃>uE[_^]jhТK讚3u}uĜ ;=ALE߃9LDtrW\YuE9LDt(WYPHu@Hut0< uE !}uWY 萞UE~ PukYYuuPuu uZ]UQQPK3ʼnESVuW~!EI8t@u+H;ƍp|M$3u E@ȉE$39E(jjVuPQHȉMu3q~Wj3XrKɍA;v?EE=wZ܅tPfYt MM3ۅtQSVuju$HujjVSuu {YEt,M ;QuVSuu AY~Oj3XrC ?A;v9}=wYtgP0fYtR3tAEWVPSuu Xt!3PP9E uPPu uWVPu$HV蕊YS莊YǍe_^[M3]UuM=u(Eu$u uuuuu P$}tMap]j AL3U$\$fD$f= {If0{IfTfs,ffVf%%Y\ЁuT$t1 # fnfs f 0{IfT$^ʺ #f {IfWfTfvfɁf%=uefL$ fT$ fnfT @{Ifs4ffffvf%=t#fL$ f%t{I{IfL$ f%GfL$ f%+XĺfT$f~fs f~ҁ ¹f {If{IYɺHfd$fT$ f {IfWfTfvf%=f~u fs f~?uf {IfWfTfvf%=uUffd$% уtf%=?rf%=?s{IXºcf~fs f~ f0{It:f~%=w%rwfD$D$fBIfD$T$ ԃT$T$$:D$Ã~(=<VЃW?&=VЃ €WXX{IfY\{IfY\f(sIf(5P{IfYfXfpYXXf%p{Ifnʁƒ fW?fYT$Yfs-fpDf(=`{IXfYXffYYfYfXfYYfpYfpYYfnfs-fnfvfXXfTXfWfvf\XfTf_\XXÃN^YYXYXf%=fD$D$^XYYXf%=fD$D$f{IfnYfs-fVtf{IY{Ief{IYTfpDfYf%@+-p< Ё=r ɀfnfs-fD$D$fd$f?f3%-K$$ƅp u; ƅp2+at@u tF t2t>-{Iƅpݽ`aAuƅp-{I uS uN uu tƅp-{Iu t Xݽ`au-{I tƅp-{Iƅp u-{I-{Iٛݽ`aAuݽ`aݽ`ٛu |Iٛt øVtV$$vCft^t̀zuf\?f?f^٭^L|I剕lݽ`ƅpa$؃#zuf\?f?f^٭^L|I剕lݽ`ƅpɊaݽ`ɊaŊ$׊$ ؃#۽bۭbi@tƅpƅpD|I۽bۭbi@t ƅpƅp۽bۭbi@t ۽bۭbi@t ƅpƅp-0|Ipƅp tUEEEEE UE]MEMEMEMPQRz Ef}tmËT$fT$l$ét`|IËB%=tËB D$B  D$ $,$ BËD$%=tËD$f<$t,$Zf$f=tf tf t Z,$ZÃ$D$%$D$%t==t_f$f=t*f u!f ttZmZ,$Z|I||Is |I|It|Iv |IUQQEQQ$*KYYuJEQQ$yEYYDz+ IJQQU$yEYYDzjX 3@3]UEV39Mu:9uu|z`KAE9EuB9uu=z AEu `KhK3F9M u-9uEAmE{[U9E u]9uuXEQQ$EYYыAu`KuzuKE M^]SVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[jhK 3ۋuj Y]};=DRL@RLtZ@ uJ@ uAGwGPPY@RL4WfYY@RL@ t PWIgYYG뒋uPj8虂Yȡ@RL t:Sh@RL P聘 @RL PdH@RL4u^ tf ^^^NE KËujpYUQQSVu 3W=ALj MMXf9tat/rt#wte3F ك 3AfE Stv  tRHtCt- tu9EEˀ@@Euπt}uhE bTtPt;Ht+ tu9@7u-B*u B@u E t3 ؃fEj Xf9tjVh|I. {j Xf9tf>=af9tjh|IV/ u @jh|IV/ u !jh|IV/ j Xf9t3f9huE SuP-}E1L3ɉHHHM x H_^[]SVWT$D$L$URPQQh@ Cd5PK3ĉD$d%D$0XL$,3p t;T$4t;v.4v\ H {uhC}C}d_^[ËL$At3D$H3薼Uhp pp> ]D$T$UL$)qqq( ]UVWS33333[_^]Ëj}33333USVWjRh CQ芩_^[]Ul$RQt$ ]jhK~3ۉ]uuԀ ;5ALs{9LD8u 菀 ZVYe9LD8t VTY蕀 }E (u}VY2_ i~UVW}WYtP9Lu u u@DtjjYY;tWYP\Hu @H3WYσ 9LD9t VY3_^]UVuF t F tv!f 3YFF^]UW}uqG @t G G u WSYGwwW:YP0 GG uQW:Yt0W:Yt$VW:W:Y9LY^K@$;LPvWB;LP>;LSSPvSS,NjXjZ3j C_k} jXj _3jB[jjjjjjRPQjj3PPPjPPSWvjPXK=KN;};|&;";~";}3@_^[];|;;~;}3kF<Fk<i3;u ;5K;5KSSSSSNj0hKI3ۉ]]܉]؉]]ԉ]̉]j\Y]EEPYEPYEPYEȉ:L K KhI?GY}ątx8tt:LtPWYYt(:LtPVYW:@PHYY:Lu EWWY@P5:Ly SSSSSxM:Lt PY:Lh:LH3F5:Lk :L;Lt kL;L<ȉMf=;Lt;Ltu+L;LkuEPEPWWVc]?sKE=sA X;r6QL >L>L>L5>L=>Lf>Lf >Lf>Lf>Lf%>Lf->L>LE>LE>LE>L>L>L=L=L =L=LjXkǀ=LjXk PKLjX TKLh J]UVW}tM t Uu3f1j^03_^]Ëf>tIut+fRftIu3uf0j"U3ҋ9E vMf9t @;E r]U$PK3ʼnEESdHVWE3E VEӋ}CE95@LhVh J|Hu&@HWjVVh J|HSh JWH?Ph JW@LHPh JW@LHPh JW@LHPӣ@Lth JWHPӣ@L}0HtEtPHH9utjX9ut5@LuEt3f3^[]WuMuEuMtf3GEPPYYt@}t~';_t|%39EPuwtVj wH}u ;_tr.~t(t139E3PuEGWVj pHu(*}tMap_4Ujuu u]UDPK3ʼnEMSVWA 3ۋ} %}EA?EAEUEu%9\u @|3}𫫫j[Ku}UܥHEj]ԥH^#UāyIA+3@uЋ΃j^DЅD9\u B;|E̙jY#ЋE%yH@+ȉ]3@EȋDMȉM;ȋE؋j_r;Es3AMԉDJx.t'Dˉ]ԍx;}؋rs3AMԉDJyՃMЋUċ!DB;}}΍<+3M9]tAK+K;}3}𫫫;+U܍uUЍ}¥EċEХ%yH@EЃlj]}Ћj EX+jE^Tϋ U#E؋MTCE;|ߋEčU3j+ЃEY;| DE\IyMAUԁyIAjX+E3M@DЅD9\uB;|v}̋jY#yOGD+3Gˉ}};Ej_r;Es3ADJx(t!Dˍx;}rs3ADJyۃMЋUԋ!DB;}}΍<+3 KAE؁yIAM܋j ]׋]Y+ˉẺM܋TˋM# UTMEE@E;|׋u؍Uj+3Y;|D\Iy; K K}3MÉyIAMj X+]׉E؋T# UMMȉTCE;|ߋu̍Uj+3Y;|D\Iy5$K35KC5$Ke KuE؁yIAj ]X+ÉM׉E܋Tˋ U#NjMTFE|ߋ}؍Uuȋj+3Y;|D\Iy}jX+KȋE% K u@u Ew u7M_^3[]]UDPK3ʼnEMSVWA 3ۋ} %}EA?EAEUEu%9\u @|3}𫫫j[0Ku}UܥHEj]ԥH^#UāyIA+3@uЋ΃j^DЅD9\u B;|E̙jY#ЋE%yH@+ȉ]3@EȋDMȉM;ȋE؋j_r;Es3AMԉDJx.t'Dˉ]ԍx;}؋rs3AMԉDJyՃMЋUċ!DB;}}΍<+3M9]tA,K+0K;}3}𫫫;+U܍uUЍ}¥EċEХ%yH@EЃlj]}Ћj EX+jE^Tϋ U#E؋MTCE;|ߋEčU3j+ЃEY;| DE\IyMAUԁyIAjX+E3M@DЅD9\uB;|v}̋jY#yOGD+3Gˉ}};Ej_r;Es3ADJx(t!Dˍx;}rs3ADJyۃMЋUԋ!DB;}}΍<+3 4KAE؁yIAM܋j ]׋]Y+ˉẺM܋TˋM# UTMEE@E;|׋u؍Uj+3Y;|D\Iy; (K 4K}3MÉyIAMj X+]׉E؋T# UMMȉTCE;|ߋu̍Uj+3Y;|D\Iy5VP^_]Vhh3Vx u^VVVVVl3UQKu KujMQjMQPHtfE]US] W}utEt 3EtVvKj^0XuM聳E39ubfEf;v;tt WVS *0}tMap^_[]Ått_EtэM u QVWSjMQVpHȅt9u uEt@Hzutt WVS2 rj"^0oUjuuu u]SQQUkl$PK3ʼnECVs W|Ht+Ht$HtHtHtHHtHuzjnj jjj_QFPW~L uGKtt teEF]EFPFPQW|PEPaN|hQR>YYt=Ku VYu61QYM_3^I][UQQE]E]UQ!tWh|Jhp3IHPHȅuSEeeEE EEEEPuEuu uE E jPuuuu uH]jh0Ko 3ɉMM3uu| j^0\39Et9MtE%@tʉMuuuu uVEPU}Et* Ëu}}t%t9Ld6`WYU8S3E EW]]]t ]E E]EP`YMu@u9EtM+tHHt*Ht#+ E R j[ ttU@}EVj^jZU+t6+t)+t +t@uuEEU E]%;(t!t=t=tJ=u"Fjj^==t3=t(=t%J E q j[ j3FÉUEt1L#Ex3BU@tME}t U t E t  t ECR} u#   ^_[]uEuVEPuuu]EusM#;u1Et+uEȁuMVPuQuEu29Ld@HP Y qPHuB9Ld@HV Yu\Hu 맃uM@ uMu7SUYYU9LT9Ld$‹M$HEjjj7ΖȉE#ʉUu8tS7ĈjE܉]P7- uf}uuu7Y tSSS7f#ƒtUM@uE%@u@ ȉM%@=@tD=t)=@t"=t)=@t"=t=@uE%=u E]]@E#=@=t[;ldjY;vFQSS7n SSS7Y#ƒjEP7؊ MjZ;tu Eu7YZj[uJSSR7ה#ƒEjY;v6"QSS7螔 tSSS7荔#ƒuQjYEHt Hu=E jYEM؋+PEP7 T M;ً 9LD$2E$0D$7ƋM9LD2$$ ȈL2$M8]u!t9LL Mu#;u}txu\HuEȁujPuVuu2@HP9Ld7NY 9L SSSSS&Ujuuuuu ]USVWUjjh؅Cu-]_^[]ËL$At2D$H3?UhP(RP$R]D$T$SVWD$UPjhCd5PK3PD$dD$(Xp t:|$,t;t$,v-4v L$ H |uhDID_뷋L$d _^[3d yCuQ R 9QuSQK SQKL$ KCk UQPXY]Y[Uj ju< ]U=XRLV51Lu3cWu951LtS$uJ51Lt@}t:uY'QY;v<8=uWuPu tu3_^]Ë@UPK3ʼnEEEE E3S3@VEÉ]W}]]]]]9E$uL3UʉM t t t uB BM {$CA<wjXJ݋E$:ujX+tHHt3@jXMjX]3@EA<vE$:uj묀+t+-t&0tC:E~ d)j|Jj tA<PE$:R0cU3@E0|*Eu9s 0@GF B0}uEE$:I+t-kE3@EEEu0uE HB0tEE0|%u9s0@GN B0}uE+ -C~EdJ 30@E j/BEA<wj +t"HHtjjXMj3@E B0t1몍A<v09] t"BE+tHHqMjXzj XJ mH3@E93k uP BM0}MQ9 B0}JEMMvE<|EMOjAXMMO8u HAO8tMMQPEPqM yuEuuEu+uPJ/@K` y Kރ`9]3fEƃTUuk ʉMf9r}MMMy U΋3‰]%]ԉE#Љ]#]܍uf;If;@f;2?f;w]7fu$FEuu}u}u 3fEfuFAuu 9Yu9tjÍU_E}}~Xuč4FAEEEM]ȉMJ;Jr;Ms3@EJtfmOM}E@OE}uU܁}ԉUf~;x2E؋ UEҸ} UUffify]]EEtCM؋Mm EE MU܉E؉}ujۉU[tf3Gf fEԋ}fEԺf;wu@Eփu4Eډ]փu fE޹]f;ufUF f@fE@EڋM@E֋MUf;r3]f9E]H%E:fE ufEċE؉EƉMfu 3f9EH%Ẻ]ȉ]ċUuEMċUƋu23ˋËӍ_#jˋË Ëjˋ[} EfG fWwM_^3[6]%CwCшCCcCCCbCDCCCnCUQVu WV蠷YN u N )@t "S3t^tFN F ^F u*Y ;t M@;u WYuVYF t}V+ʉM BFF~QRWH G N uttNj 9LKA tjSSW}#ƒt2FMf"EfEEjPWE HM ;] t N [_^]UW=1L}wwU  fnp۹#σ+3offtftf#uf#DžEЃSf#3+#I#[DžD_U t93t;DDžt Gufnƒf:cG@LBu_ø#fft#Ϻf#ufft@ft뽋}3كE 8t3_UUVuWz u:j^0} vM~3@9E w j"0S^Å~tGj0Z@IUx?5| 0H89t>1uBS̤@PSVc3[_^]UQQE SVWxPϋ}Ett<%!uuE!P!fxX<3M E ]s x&ʁ y} }E s f{_^[]U0PK3ʼnEES]VE܍EWPEPYYEPjj uЋf"u܉CEECEPuV$uM_s 3^[*2]3PPPPPWVU33D$ }GET$ڃD$T$D$ }GT$ڃD$T$ u(L$D$3؋D$d$ȋd$G؋L$T$D$ ud$ȋD$r;T$wr;D$v N+D$T$3+D$T$My؃ʋӋًȋOu؃]^_UME #Vut$t jjJYY7j^0Qu t &YY3^]U$MuHEtM E SVWt}t|$~R}܍p3ۉ]t~EPjP&}܃ HtFʋE]-u FM+tM}]EC:$1u0tj _0u}A<5|E 99u0I;s;sAfE*ȀHɈ\3@M_^3[!]À90uI;s;s̋M3ff9E$  A3@A03SSSSS>UM3tSVWt t t t t Ƌѻ#t;t;t ;u ` @ _#^[tt ;u ]Ã@] @]U }fE3ɨtjYttt ttSV W#t&tt ;u t ;ut} E## ;V?YEm}E3tj^ttt ttЋ#t*tt ;utut=1L]E3ɄyjYtttttл`#t* t@t ;uj@%@[+t-t +u#}# ;P$PE e'YY] E 3ɄyjYtttttп`#t* t@t ;u%@+t-t +u 3Ʃt_^[]UM3t@tttt tVѾW#t#t;t ;u  сt u  _^t ]U eEWuFtSVt\j=SuYYtI;tE=1L38FE;=1LuWEY=1Lun9} t&9=1LttN^[_]Åj1LYt݃ =1Luj1LYt =1Lt+PSYYxW?tR4臃}Yu}'DF<u?snjV51L} tY1LR}yލF;.=?#Pj51Lb  }d'몋}} tjjSȌYPSYYtPSS诌YPV uc+MAE#PVHuM[*V|Y}t So'YErS]}Y'3^3PPPPPUVu3ɋƅtN9t @A8uSWAjPYYuj hYt+PY>u'_[^]U 1LVWt0} WPuT u <=t tuً 1L+_^]+51LUMSVWu蓂Eu3MtU u%h;vM}uuVPRQ3-wPRPQhESP u p}tMap_^[]U,PK3ʼnEEMSEE VuEԋEEMW~"VPKYYM܋} ~WQ6YY}3|E$3ۉ]؅u E@E$t;ujX~3@~jMQPHt~+}rE8]tۋuHtъ:r:v8u뾅~2}rE8]tu܊Ht:r:z8u{SSVuj u$HȉM~Rj3XrFɍA;v:EE=w褜܅tP Yt MQSVuu$jVH3PPWuj VHȉM~Wj3XrKɍA;v?EE=wtPxYt MM3t7QVWuju$HtEPEVPSuuEVYSEYe_^[M3]UE ȋUt I:tBuI+H]UuM-u$Eu uuuuu P- }tMap]U}u3]SWu诇xW肧YYtuWS u 3_[]3PPPPPUju u ]UMVWu~Uu*3Z}39wu>u RYYAD8tBt0 9M u r9E t B fu9E u}tMap_^]U}SVWuM}}t] tM;voMEuQSW 2+MQP踛MQP詛CMtt;t+}tMap_^[3]̃=1Lr_D$ fnpۋT$#+o fftftff#uf~3:E3D$ST$t :tYtQu WV ؋ ~333ƃu!%t%uu^_[3ÍB[ËB:t6t:t't:tt:tt^_B[ÍB^_[ÍB^_[ÍB^_[UWVSM tMu} AZ I& t' t#:r:w:r:w:u u3:t rً[^_VK@8NFFF F.JPVy0Ht h(.JHH`RL^VW3jWFPz ~,~0Ɖ~4_^VFPLHN,^V>t 6y&Yff^%H%H̃=1Lt-U$,$Ã=1Lt<$XfftU T$|$l$T$D$tcWLWLfqQ΅ufqQr΅ufpPyMYu^3egXL8SgF;|IgU$u0;;uu XL6tXL 7C3ij@Y3O RWLEdx XL@ EPu$HEPu$4HjXHM+M+M jXHM+MU+ыùU #;u jXHE E f}W}Mjjh_hu ;G4u7CtjPPPP1HcF;c떍D$ t$(5HPt$D$(hSw4;D$cjPhw4c85Htw8փ<twFpp>vp>YY~c t7sc~ecNpZcQ趞Oc~pDc냋Np7cQ~,cFndPvW'>v >QdFdPvW=v=dF4=YF$G;~rdt4HHt =fSLRL?zf5RLHifMjPPjj5RLHEfESL%RL؋pRL}??e=RLeXL"s+reuQQVXL\e=RLeEPveuuQQXLS<eWeE PEPuMt M|Efu[YM|-fERLPMN m}fERLPMNl}f3RL۹RLRLuEPMlERLP)EPMl}f%RLfERLPENPMtlfjQQ6u ThjhpwKhtwK3P8Hij5RLWwRLbLYi)PH=|RLi|Oi8EFiMth`BKMEMt%wKW衩hRLMWM苩j uWPuuhwK4HPHM谅iF$it fuFGjfMfMI;}j"XFfUj YLYL0]lQՌljD$Pje5xRLHlhRLB5TLVlhKL$ 蝨VϛPL$ 荨l>jm7xH%CP7~PC2KAQ3Vt3x=sj1[6ShuQGMjS}~oGMjT}~\jQM~MEPG}IjWM~MEPG}*jXMs~MEPĕG} f9{E;bL}݄jP)~G}HM茠E܃Pg3ɉE Q-ЃE܉U EQuRb.M Muh+WhuMj}MEP huUE PEPhKMtMmGPQO`bYYjEj^fM3ɋG@E jZExH]]ى] 3 P -Yt#M PxH@XXXIyӃWLfE3@E9GqEM肓EMFu PE|M˒tEƃEM藒tM΃EAEM]tEƃ]M|E PuEuV1u!M9OuRMGwj!0u,MEPbM#wSM{uu+7u`V ,u YMbV ,u YEPMܒ}OLEMPEE@E;GuJYMkM蛓M{IEhHh(KPuV+YuJYMk3C_BN,S舌SόSIYj"ZLCf;t5j'Zf;t-j"Yf;tf;t OSP*S+YVh(Kf9 u3fLCCOPRS*Y*39w GM j4襕t F;w rG,3C9j|uFPe<uSuM:uM/E0EVu QPDYPEP踆M&uMut-郆VhKEVhKE0u 3uhHKuup2uhЃKuuT|$tEA06$xEL$`j\$p\$t0\$|Uiu%D$8PD$PhKL$l跰L$`t!iuL$ hЃKuuMxiD$jZj8T$|$YOAP覒3ɉGjZ QO MQ7V 7^NytQs~F 5UwBFG qQs΅u^HlxbLyu bLus6ȅANExbL Pu u驖HkIxbLu u-9bLAu bLusƛj Yt 蹇3Sω>苑CACAM``sPK6[N&՘阘ԬMȬ;ߛ;כ΋u踗΋诗誉΋衉+BN3ۃuÅ7uÅ$uÃuˋ+3C uC;u?{΋r;CcPQYPPw$ 3ۍMW]=VM]1M|MtMM;u"RQ蹖YPM诖P$ ؍MAM98EP胈ύEPv֋lMЊMhMEhHt-tHH2ݚQϋH;Ě3yQ&Cr7bw Z jZ+HtsHt3flh3S QY99tQ1I_YY3fjqYt S菈S~Y[A QEAEAERUlP/8YYMmc΢>lth KhKP8YY骢6lhKP@鏢j lPv6>٢P\H6y>ĢOdQ谖骢p6鑢Q(x|rQ(xg>]bWHGFߢ?֢j P|H76XH6\H6U锢j7qrj t$PA1pq6jlA@jP7[bj0f7ءSj؃t ~3ۉ7聈[@A飡}Nt u蛅b~ʢHHu8tDz2à t2Ht%H] 9REIP9]0@38t*HHtHu@]E%9t]EJjUmY]E_HHt?HHu79EIP\EY;9EIP\EY:338t@3zjHUFYx EUƢ{P\H6d>fOOp6H>Qt3)Qt>?_Wa*_W>6\H67p+6$YYm t5b~TJQWt?>5늋)Q!t5dLOۅ5dLHȅ$P轅遴QHF# #$ DP\H6|D$@H`Q߳p16CijQhs鹳Qhs餳D$@]t$@~L$ P2D$ 鼳L$ L$ Pc hdLL$$D$E E@L$ 8@D$@uD$@F >Fu 魧L$ 0Df}鰣$h@IddLс bL0BЍ$hdL\^t$u u'L$d/e JL$l*QPV t$h QP}Fݯ ݯ$ D̯P\H6h鶯6tvNcQ閯p66,zpQbqe[QbqP6t[Vt$1@p8|Q{|T$ F(q q$ DF _P\Hv zF D$@DH]N 4Q[F p^v @N Qp5N Qp"F D$@Zt$@T$ ȮhdLL$$D$u }WDfxGtk$A$A$A L$ $$P˟ $PL$$蝄$aD$PL$$aPVW|$j  钤D$P|$$D$ $DŽ$PL$$DŽ$DŽ$u L$PVug $PL$$Ý$;|$$l $DŽ$PL$$DŽ$DŽ$fu L$PVuX $PL$$D$ PD$TP诸yt$\L$jnT$T|$(T$|$D$˟|$$L$ >uL$ t^/} Ep@fWuAfXuIftf@utBuЋD$TD$D$釢u ߃|$$E u QED$x@fGuAfHuIftf@utBuϋ}֋t$@Du fxHEBA M `D$ hTK|jj)D$ hH|jj*$,ghdLL$$G$PL$$su $V]DŽ$DŽ$DŽ$D$t/D@fHtfOuL$ P$轚D$$=]uZ8D$t$ h5P$肚$]u$E E@@ Phau $}L$ P$DŽ$PVWDŽ$DŽ$P|$D$u L$ $PL$$$S$G 5dLO|e6 v 鏤 "$: DP\H7q7N\Qp+ 7<ǟQbj鼟Qbj駟7TV 鈟=dL#5dLH{%QfuF馟 $f DP\H6|D$@|H`mQbpO 6CGQi<2Qi'D$@St$@ 5dLO{鏛6v 霪 L$ D;P\H7q7&N\Q, pu7<QhܚQhњ7ǚ SV-鲚5dLH2z# $ DD$P\HD$0˧t$6N{L$ QX韧D$pD$ 0{L$ mQgbL$ TQgIt$6tRV>t$$&bLpD$ @dLDdLIohC&D$ *8 @dLDdL ohC%5pbLD$t$4#)rRD$]t$D$D$T|$-*@"D$xL$ t$xS"s|$-t D$pOt$FpP!ƃD$D$TKpPD$]D$D$T;E E@D@ PjoL$L$dY$BL$ @ Pjo輕$&GL$ @ Ph蓕$APT$(T$wGDL$ @ PhaT$(T$Q$CE E@@ PjnE E@@ PjyL$ $|T$'E E@@ PE E@L$ @ PhĔ$GL$ @ Pjn誔$$t$\jmL$联T$(T$nt$\L$jne$|$ȎT$D$JL$<T$(T$)P\H7wQll鞝Q鉝p7<nQccYQcN7D^NV/CЮ@Ю@CЮ@CCC,C,CCC@@C@CCC2C2CCC@@C@CCCCCCD٣@٣@D٣@DDD2D2DDD5@5@D5@DDDDDDD@@tD@DDDDDDhD @ @-D @UDDDDDDtMdP>餫趌#C 鎫 {VuHHΫVQEPs(3@鱫hHeo GPpEwG 魬G tt 蕇<V u݋z9WM  1qV^M kzPQ!zPE P9E pE pu 8雮 ϋE u蟎M ȉvE F ~bWVF IH wa$tDGϋȆtJjUm R//@?tޭ׭QkFԭQkF $DڭP\H6yE ­H_Qx~騭p6AQ_邭xQ_mE `TJu tIKqtQsC ݫG tt Cl)Vf ϋE u$njM +ȉAu EF ~*+WVF Q|jF E F N@w7RP PVF  G tt~܋v6RPOVGϋwtJjUm鷩R:-驩?险QiF閩 D$D{ Ct@p֭ W*VEPVkPoMoHͭCPj{ Ct@pzmPNqE ˄7.Cx'{ Ct@pωE Ԋ;H;E ޭ:uϋu;Gً؋t#JjUXmUШR+U@U鵨?TU風H wr$DFً؋蛂t(JjUmEtiRN+.S@E>t5{ Ct@p頫{ Ct@p& 1$Dp6oP\H p6K>O6ܧQ[ѧǧQ[鼧>$FWF靧KqQsCẍωE ;%9E sϋs;J wz$0DA؋t-JjU;mU餧U隧R)U)U邧@Uu9t UfU\Gً؋qtJjUmE;R/)/%@?̯Ȁ{ C +$XD>c QNxCpEPM賄#EkPM蕄EPA耄EPMnP9AM轃M赃M譃餥EEPEEMyp`E u 蕁I D D D D D D D D D DLD @ @%D @:DaDrDDDD+@[@DDDDDDDDDDvD@@rD@DaDDDDDDDDaDDDDDDDvD@@rD@DDDgDgDDhKMPguMdWE}PEPmu M P}MN@xHu Ձ>3`N@WM P- EPXHEPhK谩HPh KPJ KPhh\K@ HLKP騮hKPMC~M P节$h8KEPMUM PaM!A6hKpPX!M P-ph KP跨M Ph K`P@舨çM Pρ`fh(KHP(V葧M P蝁H4h0K0P $_M Pk0jUY.M.EEEPP HehPHF(dLhx4P%M܉}܉}蒦Ѓ}uHu >Ǭu )鲬u  靬u ~鈬u ~ su ~^u ~Iu ~4u ~~3@F ׫=RL=XLu t]~3>@F 鮫u F~@ϫu 1~A麫u ~B饫u ~C鐫 Ph4H(dL@6t+tM t hȋK(hTKhHKh@Ku3ɸTK^NV E 0@K&(dL3A8H0u hpK齪8H2u hK鮪8H,u hK韪8H.u hK鐪8H*u hK遪8H(u hБKr8H&u hܑKc8H$u hKT8H"u hKE8H u hK68Hu h(K'8Hux8$H3ihPhhRKhPhxKHPhLH\uEEPP|HXRL飨hPhHKhPhRKqhPhRK[hPhRKEhPhRK/hPh`KHEEyHKu ]yEF *xjUE]U鴪E\]U顪]C閪]MȋQK36EȃUlx«jU@]vEg3YЫKEP5]؃7QZEƪ ƪ$@$DEP\Hu(靪uN8V|MqQlfEpuHM=QN2M'QNue8VE@D@ Pj{}M{MQbi鱥QJ霥QJ釥~ VMEut+EPƝMbtE0u SMMyt-EPݞM,tE0u SMyEP yMtI- D@@D@ DC Da D D Dw Db#D(@(@]!D(@!DL!Dw#D!D!D#Db#D(@(@]!D(@!Dp!Dw#DP#DP#D#DjjjSLxyT9E O9ER9ER9EU9EX9E VeEejPWQΉ]qypRLDxMEj@Yf9Ht @ Pjr)Mu|RLt=wjhxM&sE E@@ Phx鎧U@PRuVW詧風GDUf9P(G@ Pj~ G@ Pj}/x骨U_7MuUM@ PhwjuQ2訁M܋Tru܋u E鄩w;tOJt URVWP霮Ut@ttRVWӇwA PjnURVW|YuBExbLPS8E蹀bLPS:6cEbLp|E駪}GM@ PhKz تGM@ Pjq*RMu}ȋuU3H#Ƌ M3H#ƃy u 3P?=|dL5xdLOPX麪BEPPWVQM:,MެGM@ PjyuGM@ Ph^MfpG MPhBMPh7M@ Pj(GM@ PhG@ Pju鑬Fx0EPG PS@hx,uEOjMdO p8r;O (rO poO 1uA ǀqPgjjVc jjVc PsGO @pqN;}IO qO poG,w uw3jO zqPPjsnC M\ 5$J0DF t qS@iV^k~ ] 9WR 1qVM \PQ\PP ppu8}}~ ΋EunpqMȉ XEC KDuVSC &iwpQNCU؉UQNUEU $r0DR\HunتJY˪Q6a龪ru<QB陪QB鄪|-u8eH؃$0DM luO lO(jVLgWOE A鎪nM؋n;|-poM؉Eco;|9ErZM؋Z;r$0DĩF؋gtJjUmRQE]H wx$0DEM؋@gt&JjUmEOEEDRE3mE(E@E}t E EEE.@>tبѨrjsOgjOjV-K OmˉEm;Ш9E¨OYˋY;ͨ $1DGO0 ftjNUTuVVFw>G/38GGpOIEP&u3 w$61DCˋmetJjUEƧRt鸧[鬧38頧@閧 IEP4&Ev3oNy0tQ6~F 铧QTJEY Y$^1Du؅GV\Hu~u؅0Nhu؅ Q\Ep:uCu؅Qm>u؅ݦQj>Цu؅Ŧ(V鰦*D+D3*D?@?@*D?@+D+DG*D+Da@a@m+Da@+D+D+D+D+D+DU,Do,D@,D@@,D@U,D-D,D,D-D-D@-D-D-D@-D\-D-D-D-D-D@-D-Du-Dg-D.D.DI.D.D.D.D.D.D.D.D@/D.D`/D`/D@`/D*/D6/D@/D/D@@/D@/D/D/D*0D*0D0DGM@@ PhC uMEjPE PWH0S u$MEjPE PW1]M ]GfxNt髦8jEAPE M MPW~lEuEPjujMjMǀ^ ~yjZ~njjuZ t[jjuZ PjEPMjukMAx~"jjPijEPM]jݦhHgMeMEEeEE頦MjhXKjh`yOE M@ PhMbeEEPuKL邥8ߥE EjPE PWkqEPMi]ǥ`Mt S`馥_霥ɥM`Mt `駥_靥@ MPjr)EMpdMEEZd}EPEEPSE\M]˄uAhHeMdMEEdEEE@BEP]hEPMQh\MMQ`mMƁeUtMcEEM\EPE@ĥ@ Phh鲥@ Pjrh騦eEejPEEPVixNEf9xt@ PjrhMb鳧Mney3Mb3҉UU;rjh5h_@ Pjr"h館M[fi EExEDEezEEK8BڨQSCEMEEʨ$9DĨP\HunHYQU閨pHu<~Q~7qiQ~7\T!u=CFs3ɉE QMEt MtQPV uu_f0jЃt HJHJ@ B 3҉jGF[3:s /Щ} !} MBEEPEPVeVMfxuJ8uEDfxu]U鱩UHF@ PjrebUHF@ Phe:Mjjvre)`EPiƃe@ MPh@e锦6Dr@r@6Dr@6D6D6D7D7D7DAP0`y0tQ,`Ɔe^Ɔe钫u Rr鿪u Q|s鯪\4HE 闪\釪u RAxwu EPRhlcjEPRpPjEPRi=jEPR*jEPRvtzv.Gf9Hu%8 u D0dHE AjjicөEPRz©hf鲩jhc韩uEjPEPScKEfx@ Pjrjc|bLp鍬DdL@dLc;hC2郬鳬DdL@dL*;hCpbL]NF۳qMAM@ PhbծG $BDEԍM̋XtJjUE}؋]锰R}؃]逰Ew]p]̋Ce]̋_KEPrE@]@ $BDEԍM̋XtJjU`]܃U%RUEvU3[ K|P|UïU3鹯Q=E6 6$BDE̅$P\Hux}̅ ObM̅QOEpu?M̅ԯQ1ɯM̅Q1鳯}̅|W铯MjEuPEPWuEu!U黫f5t fGɫ}EMVPW;wiRAD@ Pj{M%`醳uMj{`MQ^G@ Pj|_]jhKjhSUMAM@ Ph_īfS-fT#fUfV@ MPhs_酫F $CDEčMeUt$Jj|諺|uȋ]駮R`uȃ]铮E@t]郮]Cx]rKEPES]S $)CDEčMTtJjU ]U8RU%EsU3[KEP|]ԃUܭU3ҭAMD@ Pj{^MuMjz]jQ9E& $QCDEtP\Hux]]KbMMQ"LBEpju?M$Q-MQ-]S@ MPjr%]7@ Pjy]"EPSEPEPrSEPlP\H6\>OGp6<Q,逨vQ,k>aW7LEpP\HubuYNLEpu?M6Q2,+M Q1,u V]@;D;D"Dx?Dx?D@x?Dx?DH?DS?D@?D?D@D@D@@D?D?D?D@D@@z@D@@D@D@D@D@D@DD@ PjoZD@ PjoZBM@ PjoZMTNHQPSZ v;*jjhtMEPu莲xvuuQ?xD$ 龱Gp8O}ut$jpYED$ 鋱G]0YG@ PujyhG@ PhY鯲E8}GM@ PhɋME jPVWx] >Gf9HME jPVW覀QME PVW#y] :Gf9HٱʋGj5Yf9Htұfޱf@ԱM}U u uVWY3ɅA黱)}%ȣxWL@,V\H3Px u3ҋ|$ jVR0 |$VRWpbL?|$骹bLX鏸 t$@IMS\$|$zHGFGFG F P5Ft PF3ɺ Qi3f X鮸L$ |$AD$0L$PD$tPD$8Pt$4T T$ D$pjVPD$4@0:鿸D$(L$@@ PjyySO$PPG 頴虰;r黴Ax8 wN(5N.@$N $PQNy8tQt~F FH8\ut$QM A0*LFoM 7Aj_OPD$Hh KP\ L$D>M A3ۉD$[A ND$D$RM I ND$D$BT$,jjHhHPYYjhRLtQ%0vQt@j@PPD$HPL$DmD$@EgU; XL}6XL t(xt"$Pp0 HWLƇLJμRLRLLJ龼dLPpL$ d dL5dL3!5dLL$t$|$t98tA;r|$DL$;tKϋP.PD$ QL1Fjj@Phm5H=RLj |HI闾D$PR0WL$0VTWLtQ$ dL$P\OL$pD$pD$xD$|I$$,h.JDŽ$D$t.jD$tpbLP$4PG:$, L$p?I$$h.JDŽ$D$t9.jD$tpbLP$P9$7 L$pH$$h/JDŽ$D$t-jD$tpbLP$$P9$ƇXϋFjj@PgL$pƇXwH$w=YLu= dLd}  dLjj |H'J3Ƈ$D$hDŽ$HD$$$$>I$$DŽ$6^Hv+GvGMЉT$ JQCzD$<Z$T$$HL$fxuHT$f@utF띋D$<ϋ@D@ PhL VD$4D$($+J$ $ƇQ$T$ D$ra1D$ t$LD$x1D$<3҉T$lHL$f9Pu'$t uFfxtT$lt$L|$D$$3ɋt$$:@fGuAfHID$d|$DT$lt$$t$L9D$RFD$(D$ϋD$$D$0PD$,D$8PD$Pt$H KD$l jPD$0PD$H@01L$0tQ&D$0D$4 $\Df@u9F D$(P\Ht$(mD$(D$tiHSL$(t\Q8TD$(pٹt$(7L$(t7Q/L$(t'QD$(D$tut$蔹D$4D$(D$jR0D$0/D$$L$ @D$D$@t$LD$;Ah}K$@($3$jH#jP$HP/$<D$ jj@@PabL-$tQx$DŽ$$H <$\DL$0tQ<$D$0D$4 $\DD$(tP\Ht$(\t$(XNBL$(DQ69D$(pt$(L$(Q@ L$(Q>t$(t]V\HKtPN=tGQK6=v虷't,Q"tQtEVg$DŽ$DŽ$ $ ƇϵYش$L$XLP$t܍$PGtǍ$DŽ$DŽ$DŽ$?A$$ h4/JDŽ$$6&j$pbLP$P1$ 1ƇYϋFjj@PR_$ƇY@$ô$ȳj DlHD$H=D$HPDHD\HD$HD$P\HLJHD$QD$ PHE饶hDg(u#D$@ PhEL$PCh gPD$$PVW\鼴jD$TPD$(PVE飴@ Pjr9EL$PvC鲳6v 黴R\Ht$PpkJZ^Qi3Qr贴t$P=8Q+#QJt$iLJ$]D1)( j]xHj]y/jPH QD$ D$ PH聢w~ytui$DŽ$DŽ$DŽ$0>j$DŽ$P$H $=ƇDLJQٱj |H<t,@苩|;<rHD.3D$t$u(D$P,T$ |$dt$ UH̉D$@tFD$@PQH|$@ujHlHH\HD$@LJHu*t$D$yHKQD$ P\$H'mjPH ƇDLJ|H阰QD$LD$LPH耠錰$LPH$LPHjjj$XPօt7TDTDTD TDTD&TDGTD\TD|TD|TDlTD}VDVDVDgVDVDtVDVDVDVDVDVDUDIRDIRDUDIRDUDVD(VDVVDVVD?VDZDYDYDYD0N tN$tEPM+ E56At@j@Pv鸳E̴AjYf9HEHN}Eu^MMEx;WhSEM閵AjYf9H+EHN}Eu^M蜠Mċ蠠Ex;_Wh}tMjUN;ME}tMHN;WhAjYf9HEMAjYf9HuEHN}Eu^MME܅x;WjhSE܍M閴CD@ Ph5Wh-Wh%WhWhWh C@@ PjrSL"?۵Ht`HtJŷSD$PD$PWQ?lh`huD$@ Phgb`PD$PWU-D$PD$PD$PWQ8D$PD$PWQ裔ZOD$fx(@ Pjrc>3@D$D$;uVDŽ$D$D$jPL$lDŽ$^$ȋ$T$sjjL$4\$8ыȉD$LD$jjL$4\$8}t$jjHt}}DŽ$hHDŽ$DŽ$DŽ$D$HD$ D$$D$(D$PD$XD$\j$PD$PL$p t+$tڍ$PL$T'D$PPL$ 빋|$$ut$WjH4M 7#WjS 3tD$ Vj4S%F;rL$P(L$$^CH P+D$BM ?*jjI jFPH3ɋM D$("L$(ωD$8QVP 8\$u(SVD$X|$XPt$D\$ht$lrL$PF(VSt$L$LD$@PL$T!t$(D$TVPt$D.L$PD$('C;|I ˉt$L$8\$fKL$ P蹋YtFL$8D$AL$8;|ۉt$3 ȍFP3L$0FVQD$DSD$`D$`VPt$D\$tt$xL$Pa't$D$$L$ID$L$0D$t$HL$$ЉD$@Yu9|$0tt$D$@PL$d t$D$dVPt$8L$`D$&L$@ D$(D$0?M |$tD3@PPW5M I1 &FL$@pSt$ D$@PL$d; SjhjjW3\$d@SPD$dD$pD$dPWfL$P:&MA0%FL$@pSt$D$@PL$d3@PPD$hPWL$`%T$<3@+D$SPHA[u %F jjHQ%F jjHn~ uu ΋@xh%F u R%&3C^ jSHGIy u 6'Pn} %ω_ 7'FUPjH^/yjPHFu $&^ [$uEuA3ɉf9HtC@ Pji,C@ PhC@ PhjjrSL)o3EGSL),ҋU ;SSSSS33-PCREMEPPwt/}| UM B};u ff#f;ZE@uvuE@ EMIM9GGG;EEE=;=Džl+l0w]t:t u_  3Džf43DžDž4 @tPȸVUUU;Y[PlTJ uFE@f;w 4uMˋ` KyIɀAE`UJfT/JfEf;w Eˋ` KyIɀAE`UJfT/JfE^};t'uRыP 5|+;w&ff;4ufFf;6;usff#f;u|;s}k;stt"jRыPo uJ-|+;wff;4ut"fFf;6t|;s똋ƉEN;vf;jf;E`U;UrPx9E}E9E_xt,9EvluRыMP`m tJ&9ErCC9sJf;wtf8wu>Cf"Y}EGf3r{Ẻ}];} }F <| L+ NTIMEP$D$DE]}PTJ\TJ}ԉE؅u4E+{3f;i}ECE؅uE]ЅĭyEE|3űVQMIȃ FEHMAEM;ϋM~͋U;}FEӋ}@PuVu uYE9EpűMVuI EEԍ™‹U` K%yHȀ@M`UJMԋT/Jw F@;;ܦKE;¦ VwF@ ;עCUȉEMCEEBt Ot3UqE 3E C3ɉEUEM=HH+уUPTJE\TJEuEM}E]t5%=u&ee % EE]EH}tDv?}虃` K%yHȀ@UM`UJMT/J}=wF@8}EEtt}EE;F|78E%=Eu"% EE9}ͤ9}Ĥ}G};~7E|2;F|689}9}}GE};~ы};M<}ЉU;M}f;F|M%=uA% п9Ut9Ut yMMEAM;M|EU}(;}E@PuVu u'fG}f#f;u};}u鳞t;v~h9t;M}G;F|s;t89Ut3AE;M|%t;vFhDU}S;0}E@PuVu uR};}u}EtgE;F|48E%=Eu"% EE9}n}G};~7|/M};N|6M9E;E@E;~ڋME};_:}ЉU;}`;F|M%=uA% п9UtE y@M;EE|EU}ڝ;}E@PuVu uٚIfG}f#f;u};}uet;v~h9Dt;}!U;F|sa;t EAE;|EU},; }E@PuVu u+};}uӛt;vFh{׉}UE骠{33҉}\UE鋠E3EUmEEUSE3EUE<K3ҋEEUMEEs uċu] 1$@D}}9UG;~|"5}}tu}B;U~(}E;~|4}}t-%=u % ȁ}` KyIɀAE`UJQ/J tt t3;EMUAM;TEd}E;~|4}}t-%=u % ȁ}` KyIɀAU3E`UJQ/J9nK;MMUAM;]E}E#;~|S3}}t-%=u % ȁ}` KyIɀA3E`UJQ/J;E;M+MUAM;dE}El;~|2}}t-%=u % ȁ}` KyIɀA3E`UJP/J;E;MtMUAM;dE8}E;~|1}}t-%=u % ȁ}` KyIɀAE`UJQ/JnKt t3;EMUAM;REo}EE;~|1}t0%=u % ȁ}E܁wEw r_  uQu8/ wt~)wtD$lD_ t]0tU` KyIɀA3E`UJQ/JVh9/;U!;~|s%=uG% ȺwMtw9t t uc3};E=2-=   uG =u;=_ $= |"= =/ u=0B};vM;;~|=&tV=tM tH tC=t7s=_  t)= _= ~=/ tL=0AB};|1M;&;~|=  | =( | =) B};|M;;~|=tvB};|;U;~|f;wȋFDcB};U|R;UI;~|Af;/ȋFD B};U|;U;~|f;wȋFDB};U|;U;~|f;ȋFDB};U|;U;~||f;w ȋFDucB};U|U;U}P;~|s&f;w>ȋFDt3B};U|%t;vFh}n;}ymE@PuVu ukmM}}u;vf? u f u};u'mE@f;zPuVRQMuSHkl]lU-kll {5E@PuVu uzuZ}Sj]l]乁f;f;lE@PuVu ujl׋}j=uM9k kM丁f9Plff#f;u}%=uG% ȁ` KyIɀAE`UJR/JE;}k}WUu Fff#f;uU %=uB% ȁ` KyIɀAME`UJR/J UJ}}UGdžUrKK9f;wrf8wxrE@PuVpTJCu uKMh-jCjEE;#oPhTJoE;tPhTJ M쉎iiE@PuVu u+hiiES@PuVu uggiE䉆TiME 2iESM@PuVu ug ihEE Ehm;;mFhmhhu~|m;~|m;묉E;|hEűVQM xUGMBU;}|0u(tF|;vFhPU};mEӋM@PuVu ugfgEU؍BU;s3guF|El;F|lǃ;Elff#f;uE@PuVu uetLgEӋM@PuVu ue}gE9E5lM;N|‰M%=u % ЁMv nkʸM؄ kMEE@PuVu u e]vfk;VfE9EmkE;F|aEv nGkʸM؄ *kEӋM@EPuVu updteEӋ}@PuVu uIdeE9Ej;~|srU܅t*%=u % ȁRUZjEE@PuVu uct6eLj;\4j;V|+j;;Mj;N|jEӋ}@PuVu uIcdU MԋE;EiF|+;wPuW7/ u}:U؅F| +;PEPW/ M؍}t*%=u % ȁ` KyIɀAU3E`UJQ/J9nK;MdEE@PuVu u\]C^E@PuVu u4]^E9Ec;~|Y}t*%=u % ȁ` KyIɀA3E`UJQ/J;E;M7cEE@PuVu u~\J]E@PuVu uV\]E9Eb;~|{}t*%=u % ȁ` KyIɀA3E`UJP/J;E;MYbEE@PuVu u[J ]E@PuVu ux[\E9Ea;~|}t*%=u % ȁ` KyIɀAE`UJQ/JnKt t3;EiaEE@PuVu uZ8\E@PuVu uZ[E;Ea;~|}t-%=u % ȁEwEw r_  uQu8/ wt{)w4E$,E_ tZ0tR` KyIɀA3E`UJQ/JDqDDnDDXDDBDDtDvDD=D=D%DDDDDDEDDD DBDDDD=D=DDFDDfDDDAD/DDDDDD9D8D DDDDDDD6DTD)PA6PA6PA=D=DD1DDIDDDDDDDDHDDD=D=DDDDDPD0T~,&Tf,SF;uHTF,SH3C Q JTG};TڋWWxf8\WExf8$tvW7xP:t.jEOPV}jMQMP`E؋PmyE}0TK(TK TKbTjEPV#y}WGΉ}wPwH؋ ~CP}3ɉC Qq CEP3V 3 u=As =s7E E yHK]}ME Em}Emq=s5E E yHK]}ME Em}Em3E E yHK]}ME Em}Em}PC|3ɉC Q ȉM t"CEPRQ 3*M  0TK(TK TKR;'St ;‹E vE ~4BMa|u FP<|3ɺ Q PM/{Eȋu EEuVx}PW' Mԃ 3Mf>uRSEPwP|MTK ~TH{MCAP{3ɉC Q) K MQ3V 3 u CPvEKPWHPo E C3ҋKfHMQ} TRF9EuP0SF,$SEEjPF,yO SHMzCPz3ɉEԺ QSeTWEPdvPzM}SSHzG@Pnz3ɉG QGEP7Vm7 uS=As=s9EEyHK]E 0TK}E Em}܋Emw=s9EEyHK]E (TK}E Em}܋Em7EEyHK]E TK}E Em}܋Em]PG_y3ɉG QȉMt"GEPRQV 7|'MQWEPtP2yMQORHxG@Px3ɉG QeGEP7V7 uQ=As=s9EEyHK]E 0TK}E Em}܋Emw=s9EEyHK]E (TK}E Em}܋Em7EEyHK]E TK}E Em}܋EmPGw3ɉG QȉMt"GEPRQ 7%MP~S~t vhTJY~SvhTJYSA## |TE3҃;sf9YtzM 9zE 8BmTBE `T;VT3҃ v tBt׍;3TNjE;sf9Ytw0YG_ VUV^GNUShpf8[GHPRpf8]GD$D$PD$PD$0PD$$PV蹣zKL$0zKL$PzKL$zKL$tGO4GPQO4C|yKL$tOmyKL$gt*OOlBPQOlD$,PxPdwOyKL$+tt$(O*Y!yKL$tt$(O*YyKL$tt$(Ob*YyKL$tt$(O4*YyKL$stt$(O *YozKL$KtHL$(9O@A{KL$tGu9L$8GD$(PbtHL$薒uoD$jjj[RL$(T$Kt$HHRt$4HPQD$D$RHL$(uσRHL$(et|R9\$t}pTJVFGjY}f;t jYf;tjjXVFUFFjY}f;t jYf;t3jX4F F}JU}mV4UFj[f;SVj[f;/VF4FUE uc]NVC$C"ȍ KuJMUUPYʅvjw_A Af99t};v;sE3ۃuMu u7T ;}؋EMU@$ AME u@F]ˋUPYʅjw_A Af99t};v);s%E3ۃ w9TE$HEuMu SS 33@ F3@ETF]jw_ CA Af99t};v;r#E M@Pu S:S }TETpTJ4FSFpTJȍ4NSSjXSEEEf~ EVEGP9V9U 0V9Wp&VN3B }u UUWCUYYUVjJ^f|w*}Y:Zj\X;ujEZf9VU,u 3ɃM[Etu+qf+pfpu3EE@ZjvXfC]f+q3jZf0fHuEaZ;wA jZ8t u>;v}j#X;jZQ|t4;qs_uPqDM( tA4Fu>듋I+;M(wf;u;UtfFf;tjZ}utff#ǿf;uu>fa땋]Ủ}XNU̅|]XYhh^]9M,uE(+pEf+pfpu3E9]XXEjvZEfjfZ‹U(+r3fPPf0uUX^j:_]f;t#f;ȋE(@ M(3EȿEܺ ]KEuUf;wI jZt uf;vUЋ+j:YEf9uBjYu}ftj)[f;t ufu+Mȁ&Ej)Yf9W3ɻP\KM;;uMPfYt#EUЋMB AUЉM\K| kE T\K;u_}%](EUK$Cltj^ffAf֋ u339K\jfXЃ}UutMn]ȅuN%MjfXȉMG39X\K%X\K}jfXfPuW <_3fjX}](|~KdECpuj X9E-]j<%E3[j:Y;A(j!Y+tk+t.t H^j)X؋EE]j)X؋U uftj)Yf;t ufuf9\E F%j)Xuf9ukFj*Yf;t_j+Yf;tWj?Yf;tOj{Yf;uNLu;jZ]ff ڋM(Ej+A@f3fCX3EYU(j~[B\j?X։]Uf9Fu=jCYf9Nu4FjYj0_f;xw ANf;sj)Xf9Nj?Xu QVUf9Bu(Bj=Yf;Bj!Yf;6jj'XjXUu(f;$tUf;t)f;t f;Pf;x3jXuf;Pr)j9Yf;wk jXЉuj0Yf;sڋMfuЉuf;-},Bx@@!U(tj-X;u B@+ÍXZ@q;ZDhUfZW](3C,[0~0QMVYtE(GM܋@44F;|ދUuȋuЋE;u}GM;}SM(Y4u܋MÉEȍPYu E(FG;x0E|;u~UEEfBfBfrSWMUUfBfJ1WEjR_f98u@]3ɋU~j0_Pf;bf;xUk ȋEB;|օu듃}5jK`YU]fBEuEVj+Y;tj-Y;t/Yj9Y;Yj)X؉] EEA\j}Xj[U(jB\XuHj=uX>f;j>Xf;tjfs+3؉EEEȉusTujXPFVPrXE },fjXjxYfFfNfF Dž|u0E(jZH @;rQƋu(j+F^;uBfAEUuT]f9S]UZ'VZMx; V}VEfZu3u(fMRjX^ ?PEPPW jX؋EjYjxQfXff;ًE]fxuS3fMjZ9^ ]PCSP2WE EfjZf3]fډ]U;8M,tHB||5| =( +;UM,dt}} MMMԉM}};ۉ]EM(Suq PE( P2E++EJM xYE(MP JM4r@<+M+M(B9A w9us&Uً}fC fjfXC ;r}]MGEUu} AM;Mu}xT+lT|jZ+3;| =+;DTE]UÒ] ME(jp XfЉUt3fjXЉUU܅u3E+UjUfXЉUQuR_E( P2E++EM XE(MP JM4r@<+M+M(B9A wM;s8U](f 3jfʍEfȋC fMXC ȉM;rы]OUEMuBUu3$S+A +Bu؍CEjx^jf0^ffJЉEuUMMЍrA+f;tf;u}tff;f;},u33Pu(urXMЃ uF4Ff>wuՍCf}f;tf;t@j{fXjfZ]u]3u(uf+jX"Z 6PGWPS jXظjZfj{Xff3ډ]fwEtf9USu3}QEyfuUEyfSf;jUE ;Uu uCdNCh]jfXPGfZ#ljENjZ+tHt Ht3 j'j_j X}]tVSff#f;u@ff#f;ujX++PR|PNu RR[jXf;BRE9E6RE(]@h tERAQE4RM;EuEjyu%}fWR'fE,}u?u E#"RMTEyu'fEHfjX}RMG)j^fyEMf}yX}t7t/6P|PWAUj+XU;u"jXj0u_f;rj9Yf;v2j?j-X;u$Ff;P7Jf;x*Ju3j0Yf;r,jZj9[f;wk j0uYf;sU]f9xj-X;aU(B@+Ǎx<jj-_;t;Jt!UtX @I IE( HdIMImt"js_;tjx_; IjX~I yIE,t9IW`Ij]UE9p@FufF},F3jx_AB Af99u}f9Fu;U*FjX;&;UsF ȉl`iFx,MԋMUdMMFj}Y;FFj+X;U(z@uj<_Ff;tf;$tf;t jEXUF]uf;uj>Xj'3Yf;j}KX؋}(j0YjXuuЉuf;rj9Yf;w Tf;w'O jZt uf;vU uЋEM,+f9 j Y; U(3ɋًr(9J0~%;~uW U(Yt EC ;Z0|3;Z0}~}BTMԋEuME̋]jX]jqYfjXj f;X;]E} BP;zL~zLJ$kU(3ۋJ,M;Z0WV|Yu f9D~uU(U(CB44FE;Z0|҉uȋuЋM;Z0}9}39Bx;B4u]CAE(U;X0yӱUЅuM(FCA4BU;Y0|܋E};}uME̋]jX]jsYfEjYff3ًuȉ];>}Ћ](j X;ЋE} CP;SL~SLK$U(},]r]3ftE(UWH覢U(YuP;zD BJ<4xBH89B rM AKU(B +Jj_fz +3f9Fu#9E$RuӋu 葧  U(juXf+r3jXfs؃}]d=MM}=A;t uEfAC44F;MM]F=VU(MQA;t u!=EfA=U(9ZHHJHH"HU4jKHj XHRE]PE]PM I]3jY;]j3;fEf ZffEfFV]KVlKj[+U]U}t f7## ȁn3U(Jd3t27KBhM4t3t E 6U3uȋ]fjXjpXfjX3ftf~WjXf ЋljU+ƒPRB P= tuj 3Y0@;rj XP0Pu_ ]߉}M+fA>30@;r5E K8E ;*E BE TE #E j'j+E @E 1j*E E E + E 6?E ?E lj:4j0j0j*j>XUE jYv?E (h?jjE Y,$GG?S E 4E03s2uEEPEPM3YY~uUBJMPu uJAUM;r;v;vG;w}뤍F;ruQMRu Uu>y;>}+ދuC]]E @ уF;vu}]Ez>;{>}q>Ut1;sjXfύB u=3@fB(;sjXff2f:u3@fjXf2ЋEU> % >gYj0Y;j9Y;v_LUtEcjY>u Ev>vEDc>Gw @P>E9]u^FuEf;EEEr5Ef;w*j0 |uk FЉEYj9f;YsыE;U ~{u>8=j0Yj7+Z@EFf;E=f;=Ѝf;Etf;Et f;Erf;w fuftj}Yf;t jj[}uQ9]'kKt f;vE"::(=:EI:EO:j7Z@EFEf;:kK:uEar EA+E}|P:EFf;1:kK$:Ff;:kK :Ff;9kK9Ff;9kK9j7EZar A+Mu܋M%;EL}9f~{tEQh9j0Zf;r?j7Zf;w7u0tЍ<%;vj0Y-f;Esf>}1EP9f; f;sE%"9Ef9F8N觙8E%8F4Ff9t> U FJAJt;;J s%E +P;9E ;H r3f9C9M9f9Fvu=| =8u ӋWS7YY8jwYF4Ff9tN3.Y7f~ 7_P7} 7p7u W6YY7MjwA AXMf963@7jHXf;7j;Xf;7j.Zf;ËNytQ~F *afzW!%HJ]}+}MM +]E;;Ny0tQ~F ^uNOKF ƤNy8tQy~F uNmCF NEVF GPp芶YwG pPtYu^Ë EPMMqQɾ΅u^騧M 2f;EuEf;uEf;uE j#Yf;uEGjM!PHttMtMEzPHktMtMLEBu ׋uYYpjw_F4Ff9>t}u Q}oF4Ff9>tu u蕨YY7.jw_F4Ff9>tjw_F4Ff9>tuu Ruu jV uu RV谪 uu jF Itt#Ht3HtH333u Qu Qj@Zu Qj@Z t HHt#HHO` KE`UJ T/JG;vȋM鲨M A A 8M部3}PCREHIu t:y>1u t Au tyыu t3@u tBt{뢋u tBtB(é黩u z@q9{h3G`u @tA醩u @E<eu tAVjXRu @tA7^]VV:u ~ t3^3@^Ãy u3V;VsY^VW39~vF tQF$G;~rf_^UVWF 9FuN jX;r3ɉF jZ Q蕬~YtFtPvWv~jcYtug73NFAM8UKjNBUYjf9HYt] y u CD@ Pj{Fu3ɋ3~]%.F;|]juQ&* uu jz;3M5_^[]UQ} SVW\Etu uU} tbLT;rE_^[]U=RLWtEu3 38WLt9tjPPPEPHV3} WLt9; XL}*XL t9ptEPp0 Hu/ WLE买WLPzuEPHEPHjVVVEPHuƇLJ^=RLu3LJRLRLRLu3@  _]UVuqoJ8aM ^H]UVuqEH 86^@0]UVqUΉPM ^H]UVW}fGfFfG fF t0j9Yt HJHJ@ B 3҉&Ffu GFf u_^]VVJY^AfAt!fRtfStfTtfUt fVt33@VN 2N2VY^UVWuWLȿ XLj0(H~Lt~LWu @HjWV_^]UWy,?t.A0MV0V}tQ% dL^-y u%=YLu dLd} @ dLjj |H2_]UVF 9FuP jX;rW3ɉF jZ Q蘦~YtFtPvWv~_jeYt M 3ҋNFF^]Ut@E ]UVW }; S3ۅ~$$CI; |Hx%ItjjVF% tS353ɉM9 ~Jt u"M$$AM; |M; i[2_^]U0SVW3V]|H}^^ G H$jEj Xf32t3fFjXf[2jXf2^jXf2FV jXfjXf/G0xH WfHuCSVXH6uSMPEP\Hj)2tj XfFj*23@f Wf)Fj$Xj(f^轣Yta uSMj$Xj(f^薣Yt: uS&j$Xj(f^oYtPP؉^ Cj$Xj(f^BEYtE3PCMPÉF tM]_^[]IhEhEhE%iEBiEqiEiEUiEhEiEiEiE7jEdjEjEUVuMxP=EP\H^]VV|Hfƃf ^VV\Hff ^UVV\HuVXH^]UVuL$ PD$P\H^]U0SVuW~ Q EPSj 0H23υ~*EAQMΉ|!MDM;|֋EfHE@u,HEP|HE}Pu}}}E(Hx|]MV0uj#upHM~'<t4MEPSXHMG;|u$HuM+EP\H1u HuHM+EP\H uH3_^[]UMV?Pjj4HtuB 8f Hff>uRM:UfBCfD8 fFB;|uJ$tHtHtHuj 3jjYfN BFBFfBfFERPQP3EtPQ_^[]UQSVW3مt;WYt0荇uMEhjQh,,ISPuQYE0_^[]UTeSVW,,IU̍}ٍMQh|,ISMQxuVP VQhjSPMeURURQPHMwURuQP}EPQ 33}܅EU!}RVPQ}EURVPQEURPQ URB0EEPQLM9}vLEURWPQ u4EURuЋPQ8EURjPQHE;EEPQG;}rEPQ}F;D}MURQP u܍}EuܥPQL}uWeEPEP4HxAuMu,HjhHMPM EPu8HMMQPjEPEP7 @_^[]3G}QEPQEE)UQeVMWQh,I@VuuVP VQ%MQhL,IVuujVPVP_^]UpSV3WMЉ]]kMcM[h(wKMVMhLwKM|MUt$j\Xf9tf9Gth\wKMvWML9] tLj ESPp ]EMPhdwKMESu EEuPHEPhu$HutEPhSuuH=HuMEEPPSSSu Hu$E3uEfEP0Huu׍MMM_^[]UEL S3Wu @ URhjQPEUVRURPQHyMQREtIU3RUCRU؉]RjWPQ,MQRMQR f9]] PQ 3E3uEU!uRWPQ}EURWPQEURPQ EURPr0uQLvsM39uvhEURVPQ uPEURuЋPQ8}uEURjPQHEURVPQ$E;Eu EtEuBEPQF;uruEPQG;} EPQEPQub]3FuŋMQSP Mȍ}jA(Eܸ@^fA6tu܋QSPL9ut SPEu} 3^_[]VWu!'V\@YP(Hu VPYY3_^Ujju uDH]USVuW} ΋CGPCP36:GSEP7 QQKOƉN_^[]UjvYM` =dLt dLAdLdLdL]jhIhwKjHjɶUVyEtV腑Y^]U0SVWEEP3ۍEQMU]P]u  uMYE܉]PEPEPulHbj ESP賰 E9]tjj EPupH.u LHMQQBMuY9]tJMЅtCÉEMQPuHMAPQjjVtHE@E;Eru LHPjEtHPpHEu fGGPu LHPPHtmM] MAAGGGPWjjVtHtYv \H6-Y^UQSVuM3WVS1EWPHu7@Hzu/6jtHPpHMtV6PWuHt3C_^[]VWWjtHPpHtjWP,Ht3@3_^USVujtHPpHt3CSP(Hu3^[]USQQMMht Tt2ۍM[]U\SVWQQM]QMu2g3ۍEj SP]]]]]航E EE E] tE MQQuuu P(jYMt)EPjQSSu@Hu\HEEhShxKHcZHVEHBhSShxKH&EPuJ QEfE PuEVfEEMQEf]PuEW/E(@xK@,%E9]t,uR3@jZ QuEP8] tEPu\Ht\EuSuEPXHtDu,E u( u$uPuSSuSuDHt8] tEPEPu,9]t uuTHMtVHtWHEtPHu\Hu螈}Yt uPHM%_^[](UQS3EWEtG Etj_Et9VE]Pj `HP8HjuEPXHu\H^t/Eu,u(u$PE PuSWuu uHHÃ}t uPH_[](UeeMSVWQQMEQH 2u tlE3}9xv_MQ24jv?}FEjMQP蹍 uEG E;>r݋}t EG};xrtVjtHPxH_^[]Vq Vjj(XHP4HuVj(`HP8Hu!39^US3fEE]PSSSSSSh j jEPXHȉMt!EPuS\Hu!EdHM3[]UEujPuu uTH]U SVWk^ S]躅S}诅YYNF39Nv+_CS4QvVN#;t G;>r3HXhXPWvM tXP hH3ۍXY_^[]UVu'thPh'6H H^]UQSWu؅u2%Sjh 7HSj h 7H_[Y]Sl3ɄUV3} uE PhjVVVutHtjVVu`HPHPdH^]Uu;E tPHu]3@USWًM hH}jWqhHWPV^hPHHP@$ShEWxH$6h zKPߖQM jW^ jW2_[]UM ]USVW}hPWHHhH؍PYYu"$;uSt33@_^[]U,SVW3ۍM艟ME puuSf8[?M FPf8])FEu EPEPEPEPV |yKMityKMityKMit0mQE؋P襹Vu oyKMYitu؃ YCyKM-ityKMitu؃@蛓YyKMhtu؁lYyKMhtu؁=YyKM}htu؁YgyKMQhtu؃Y>yKM(htEPrHMEu 9uVLJ2tD(,pt+x'VPܒNYt ,y3ۋ5xHWh9Eu$9u6t-$PLJWh9Eu֋t PM1M)_^[]UE VVh9Eu$dž xHt P2^]UM ]U, SVW3ۋ\$ uD$(hPVHHD$(PrYȉL$ t$qxDt(P腑NYtCyL$ u(;,;+;QD$,Pp $D$($P$8hzKPx$DPn_uOVhynD$ tiL$QhjPhwVtHt$ t<9\$v6hD$,PVOn3f$,D$,P舏YYu3CVOkn3Ft$ tSh$4PuHH$0PL$D$P襵L$ܲMtCt$ F t!]SH9RCu D$PuHD$D$D$D$D$PuHPpH@t;D$uCFy;D$uCFtD$ +D$9uCFtD$$+D$9uCFt1h$4PuHH$0PYYuCFt1h$4PulH$0P܍YYuCFt;u$$;uCF;u E33@_^[]UV>t6bfYjeYtM3^]UVWuHYGpVPGeVuP&f詶_^]U} uuujjju`HPHPdH]U}tjj1TH]UQQVW39wwJSu]_EYt2UEtff;uMuF;sEЃ[_^]SV1jV\H@VtVjV\Hu^[Uju\Hy3]]%HUQQS]VS6HtO} tEȅt<s EC+W{+;EEPQpHEMljCKC _2^[]USVًMW]3lt2؅u3ɍsjZ QcYEWVj 0H~KW Y;u73Ʌt9 |)~$A;rWMuEPM誮 MWgWcY_^[]V6蹵t3^jjj6H^USVMhP6HHPMEQM0M^[]Ujuuu u1H]US]V;WôCjY9F s:jZ;rЉV 3ɋjZ QXb~Yt vbYj~YC3Ft*Q.bYt K 3ҋFjYG;~r_^[]UVaEtV`bY^]U8MVM|u~hzK6YYh0zK6YYu h@zKjhPzK6蓋 uh`zKjhtzK6w uhzKMdjj&j hzK6O uDhzKM,] hHMPj:Yf;t1j;Yf;t)j]Yf;t!;wAQMP1빺H\?s3|H]Pj:Zf;tj;Yf;t j]Yf;f;uMhHqDPYE@PEEMj;Zf;u f;uEQM9>v>W  t uG2_^[]UM ]USVW3|$ C@tGFt$ Ct/hD$$PuHHD$ PYYuGFt$ ChD$$PulH{ uD$ P|YPD$$P|HC|$ Ht,HtHu>sD$$P軅YY(sD$$PYYtsD$$Ps訆 uGCu,hD$$PuHHD$ Ph{KbYYu|$ Ft$ Ct{hD$$PulHD$ PL$D$PK4藫L$ΨK4Ct/Cu(hD$$PuHHD$ Ph{KYYtGt$ Ft$ CtIhD$$PuHHD$ PL$@D$PKlL$MKlCtGt$ FCt;uutGFKtkD$PuHKyD$9uGFT$t 9uGFtD$+D$9uGFtD$+9uGF t;u;uGF;uEP738C3@_^[]UV~(u0u{t2 VhEuƆxH^]UM ]UQSVWuPHu {3PPjuHEuEp3jZ Qg[YWVj uHM3fO3F,8S uWyYPW|Hs$WYYtƃ3W[Y W~[Y3@_^[]UWOItVq8QK΅u^EtWA[Y_]UU SV3ɉuW~ N(N0N4fNt 6WY>~_^VVWY^VN{Kt QPfVWY^USVW}3ۋGtXE tw1GURhL-I@ PxgEwVSSSPQ EPQPQGp0QR x4jPQ(GPQRjPQ$Gt@3@_^[]UQVW39wt5j@]VYtuu uWt}t Q3_^Y] U M‰Eu h@=tSVWj(H5HjXSjZSSjE$H]5HW3h u}sh ։G_^[]UQQSV3ۉ]]V  FPpjv(SjRQ,8^=u8^E S]VpW ytA;Cuu tBOu_^[] UVutt Q^]UEPEp4HEPu  H3]UE@tE 3]UM tE@t @3@]UM tE@t @33@]UESW}3ۉGH E GPu HGPu HMYG_@A3Y Y[]UVutMuDtyHt~<ulxuftjQPN FPvjv(jjQR,?Ht8xu*eURh-IQMtQPEPQjQP^]UE =;uE j Yf3AfH39=+uE jYf@=u E j Yf3=t]$USVuWj[Sh,IVX uO(E 3Sh,IVX uO0Sh,-IVX tSh -IVnX uH Sh,IVTX tSh\,IVAX uO4Sh\-IV)X uO,iSh+IVX Ot u V@_^[]USVuWj[Sh+IVW u E 3`Sh,IVW tSh ,IVW uOSh,IVW uOSh -IVkW uO 뜸@_^[]UVuNQAȋFHFHUȋFRh-IHF@ Px2FH PjQRHMFPu QREPQ3^]UE@t jjpXH3]UE@t jjpXH] Uuuuu @H]UuMu Ik] UuMu IB] UuMu I;] UVu W}tVPGHtQPG_p3^] U} tEPEp4H3]UVuFtp8HFpVupu3hH`TfH K$芼XKK4hHNFF 3^FXFFUhHKDH_^[]Ujh8Eu eLh5xRLH%eL]ы ;J~BJB;B ~ ȋB BJ VhHN4ۻjvTH^USVWjc5xRL(HP3ShvTH=H9^(vv$vT9^HHvhvTvDP׃~8vhvTv4PF HftjPhhvTӃ~~jvhhvTӍEPvTHMEM]+ȉEE+ÉMEF;tE9N t^ >~E~~FEN$H{tv$vT׍EPDHPHMF@tE+E+E+‹MF}tE++E+‹jWuSQvTHEPvT4HM.E+E+EEPjjvTH^z"F IJjPh vTHFX_3^@[]UVhvTHtahQPlHFtfu j H4^zh vT HPN4ujvTH^]UVW3}SjvTHEtiMQPH}M;~ Njȉ}M]U;~ ËڋЉ]U++Ӌ}jRQ+ Wj X++‹ȋE j[QuHjvTHEt_MQPH]M;~ Ëًȉ]MUE;~ UЋEU++jRQA +‹kE Wj[+PuHhvTH؅tNEPSHME;~EMUM;~ ‹ыȉUMjX++jE QPWj SHhvTH[tjOQM Qj j PHjjvTXH_^] U} VuhHN4褷jvTH^]U=eLu3]]UQE eLtitQ-t5HtHHuuaEHtHt3TIHB?zTuEBTH-E@@rMPPu3@]USVE W3P}KNFYLEFd}K^^ ^$F(@F,EP|Hj ]][EPNKuEP\HM \_^[]Vd}KXvHY^VWW,}KG(HD BG(@H;rw(NNF4dHFYN$OOO_^UVwEtV(HY^]VW3G40\H$|_^UESVWt]tx0M藷Muu|H3p}KPEeYM;u.UMtMff;uMuM;a3G0rML_^[]UEuW @]UM t%Ht"wEu @4uu[ 3]$Ujh+Iu TM tjh ,Iu >M t@VuVPE03^] UE xv&EtuuXHy  3]UVuFPPHutV_FY3^]VW39~v/SFtS\Hcc S,FYF$G;~r[f_^UVWF 9FuN jX;r3ɉF jZ QnE~YtFtPvWEvE~jf@N(FL赍VBY_^UE$PTH]USVW$|$\G($G,$G0$G4$E PnEL$`$@D$OEO_^][E9EyEEEEEEjEGEE     VWFȋxtQ*~u!~_^UVWj8Ytfff H3ufCtGpww_^]UQQSV3W,,I~K{CCC CCu u{(˥C8wE3PC(uPjVCPHHxu9sC@}jHh}KW{HtnxjeEPh+ICPׅxCMt<URS(RjQP x}t u\{uC@EPQCC/VHCT_^[] VN~KtQPCN tQPVE7Y^UE8PTH]UEHtuuuuu QP@]USًMjSșYx2} uVW ,I{(_^!C(Pu LHyCCC[]UEHtuuu QP@]UEHt u QP @]UVW}蘟FPh ,IWWP_^]UEHt u(u$u uuuuu QP@]$U VWhPvHte~ WjP HxEjP78Hx F7jP7hHx FFFJF@F_^]UEHt uu Q@] UVuF8PPHutQ3^]UQV~t_F MQPRxN~uMqAqPAPQlH ~uMqAqPAPQpHF uPQ0^]UQESV3W]wpK__ ___G G$9] tdu L VhwtHxI9tE E P6uVS!EUGRuPQ8EURPQ EURPr(QLtEPQC;]rGPQEG^[_]UEHt uu Q@] UVuWN~ t QPWPHu*V(Y3_^]U0SVW}WuHE3j[ Qn'Y3ɉFËىE]E|9M2j ZUE(Af9OtOf;UtFAj fXCOXf;uE@EFj|Zj fXCXAf9Otf;UtFAj fXCXOf;uFj;Zj fXCXAf9OtUf9OuAf9Ot3BXAf9Ot+f;Eu j XAf9OtOEԃ)t FA}f E D E]Uf~ f1 G@;|_^[]U$ !VhPv`jHPHPM~Et"hHuuu 0hKDxuu h؁KPu> 0u hKPZ>PM葅uMPh KMCuM8h4KM+huujHMi`Ma`^]UX S]VW=HhP5bLj׋5HP֍PMhPu jP֍PMÄSvSE8SbM̋(}EPVtuWhKP6=Wh؁KP%= PM\]MS+IMV M|}|8SMjuMihY] u @]jMgsMP }i}jM=sSP~IJ@IJuOPM }(}}@IJtj}t jP^SP$ FjMW }t ~l^}~VFBj M }E}E܋P ~jM FY~jM hM }t ~|}tR~FhM }t~F}t~FkE܋Pf~\jM- F~?jM r~&jM Fl~ jM F~j[M F5~j[M F~j\M FE܋P~j\Ma Fu~ t jSbn~ujM9 E܋Pu3ۋWMpf9t'WMvpM܊0P E܋PG8^ujM E܋P]MHOM@O_^[]FFFFNFkFFFF F4 FgF.FFFUVW} ~GSM`ub 3ΉEfEEP^SEPOuS[_^]UQESWWMHf؀8] t@V5HQjjW֋MPu M?QjjW֋MPuM ^_[]U SVW}~ G]}t~PHtÀPH׋<u~u ~uu~u~u RPhRPhjPhv HPt!aQ<ujjuu*fE3jEEB3!M!MPRUfMH_^[]U SVW}~ G]}PHtÀPH׋<u~u ~uu~u~u RPh RPhv HPt!)Q<ujjuu*fE3jEEB3!M!MPRUfMH_^[]UVuu^]UVuW>u~u~u~u ~ S+w HPHt]>t M~t M~t~t~t[PH>Hu~tG&Pjhw Ӏ~tG$Pjhw ӊFt=~uuG%  PjhtG%Pjhw Ӏ~G)Pj[hw p38tG'QSPh8^tG(QSPh8^tG$QSPj8^tG%QSPj8^tG)QSPj[[_^]UVuW>u~u~u~u ~ S3w H"PHt]>t 20M~t 20M~t0~t0~t0[PH>Hu~tG& Pjhw Ӏ~tG$ Pjhw ӊFt?~uuG% PjhtG% Pjhw Ӏ~G) Pj[hw v>j[tG'QSPh~tG(QSPh~tG$QSPj~tG%QSPj~tG)QSPj[[_^]U(VuxwujkseEPHtWuEyHK]E]j|HEPHM+MEEMEm]}]{V|H^]UQSW}مu { eeVH} j4HP`HjPVoLdHE t8EPW`H oLoL;tjPQdHEoLjPVdHE} uV}uPuLoL;uC;oLu;c 5=dHt j5oLVסoL oL;t jQPסoLjPV^_[]UA t7E3ɃeAefEE fEEEEjPQMHjuu uH]UV3FF EfFfu2EPHftS؈jPHFtFtF[tF^]UV33ɉFENNN ~u =u35;u=uyy QljA AQuA P6F _^]USVW}ك?u GPEwj OYU"zKu!BBCEKP5_^[]U SVWhuj}YYtvЉE3҉UB3ۉEω]}!Fuj >YEu `j(Yt O4^3ExKMAGAGAPOgjPYtMq 3U3ɉG 9M~z9t A;M| BM[QuM]M]MEFVAFA _F ^[]UVuW΃~ u+vɂRPu_^]UQQEPEPu]UVWuCU%N} 4'NUDuvu3_^] F7UQQEPEPu u]UEVW}ׁAM!tu P9zu9rt@u3_^]UQWu Dut@ 1} t} t} uw3jQiYPu_Y]UWuu u$t@ 3}t} t}u3QQYPu u$_] UVu FM^;H~3@@@ ]UMSEAEAEA ME@F j_h@KL$aWD$PL$(\؍L$@F h\KL$`WD$PL$([؍L$;E9p@x uL$QL$P%fEt6D$ P3tH υtE<MP o*E t"E@x u3WPD$(PHL$ ;_^[]U(SVًMWBC3x~`C@H9u(AeEAMEEPEBMAPMtMEPpBM9zF;|_^[]VjYt3F^U oLVu)%dL3Ƀ%dLA dLhC oLUYdLj*T}u.hH^jj*MJEP VM9^]UQVWj}σ uxEPEPwEPEPs|RP=tEPu2_^]USVuW>VtWtu E CFH tQ@VLYK3ҋy~I90tB;|OCHD B;|sNNF4FYN_^[$]UQSWj]}uutu x |[Vj(D2ۍMZ%^[]VWgg (w+GjjPV7Hj(GW_^US]3WPP{PPGW3PhHEu M $5VPY3PPuVW3PhHHPQM V%VY^_[]UQVjEPu u6HEFV^]UEVpV0+^@]USVWG,tftatPtKttM%EPu,%M%EPuEPM#!u$EpV0(;_^[]U ESVWp8VMXYPM]3҅t+ϊG9D;rMVS;ƍMo_^[]UVfFOQjYM^]USVMW^S&D3t1WCf8 u j MCWCMPCG;rύEPJM"_^[]Vu ujjjV`HPHPdH^U0SV$8PD$<PYYD$8P$<P8Hu>8Et2D$8P$<PtYYtD$8P$<P H2$8&tL$8}tҍ$8hKPU$@P3fDFD$DP3D$fLD:$8D$D$8D$3D$D$"D$D$fD$D$PH^[]ÍD$8PL$,"FL$(b؍L$(-!L$8I5USV3WM̈][>MS>MK>MC>Ű"UUMM̈EKt VMKDMt VM6DM=M=SESPUM 8PuHE=H<8dPMDEPUMYM EPM@GEPMBdPMCM t8]SEPM?u܅t׀} u,8]uuu H'U܍Mt@uU܍Mzt'E8PVHEÈEVH VH]M1M)M!MMM _^[]UQeEjPjj21HH@]U $AD$ASD$ A L$VhHD$jt$L$ ;uD$P tD$P;u L$L$(L$>QW\H_^[]UMEP9EPU̍MYEPU|YSMc8f9thHM ;ESMC8f9thHM:EPMa9MEPU9M#MMM M|MM_^[]US]3VWMˉ}EG;hKV^7j*Yf9tVN7P6Fڋ}uuW/73f9tW 7Py6Gۋu}FV73f9t-V6j*Yf9tV6P=6WV=_^[]USSPQjHPHS3PhSHPH8] t%HPPPSPh`K6hPPSH[]USVW3ۋShjSjh@QHu2&9]uWS }SuSWWSVHV\H_^[]SVdLWˋ9jh DFVxHSB<_^[UVh$VuHHf>tWdLVm8h+Ia8_VY3@^]UTVVHu L$QVHu PHD$^]UESVWPWpHu2VYPE3VPWElHuV3ɃjZ QhHWhHV<hKWghHVVujEPEPh0KutHt,EO j0VjZ̵jO(VjZ軵u hdKWYYhHWVW VWYYhxKVGYYu*jG PSu3fCVWPEPEPWutHtXhHVEYYu)EPH PQPRhKSghuSw 3fEuWEYY_^[]UQS;Mu!VEPuSV`HVY^EPuSQ`HM諾[]UhVWPhHhPHPHtwP 39 t @A8u;~hĆKWYYHjtEP uHPP< VWSVH hHW7YY_^]SV3Wf9tPYtG~f9uVY_^[3UVP3PPQPHP3^]U>VWhP1HύP3_^]USVMW>PM ]3}WECEYt3CfIFVRLxHMW7_^[]UVuuOVPHu =RLu;Mu,EPM3`EdLP1h+I3Mb3@^]y + u3ًU$SVMW,M,3ۍUSSS USSS EMSP.MM_^[]QHtt2VVYtVYufu3@^3^UQEPhj3PPPQtH]U SVW}3ERLڅt2RLHE3ɍE}PQEPhuOFQQEu uSPHtjVRLlHV\H=RLu_^[]UV+j#+ȉuE #MEEƉEEPH^]Vf>h\CKVwYYhCKVbYYujX^hKVLYYujhKV7YYtEhKV&YYt4hЇKVYYth܇KVYYt3^z3Ʉ l3ɄA^3@^BHtHt Ht2j jjX3QQQQPHHtHt Ht2j@jjX3QQQQPHVhCKVpYYuPjxhBKVZYYuPjPPhH^2^UPoSV$XPY$XPrY$X(u2$X3}tݍ$XP$\P8HuB$XP$\PYYt $XP$\P HD$HP$TPV$dVPS$XhHP$XP$dPf9t$HtD$HP$\PYY$XPL$ /$XPL$[VYK}S] jEVPw3fEEP74^fVrejEVPE3fEEP4^fGVgr2jEVP3fEEPfGV7t4^V'YjEVP3fEEP4^fG]VrWjEVP3fEEPVfG Vr(jEVPg3fEEP'fG 3fG[2_^]USىUWSl+ƒY;t2JV3~@fsUfEMfDsfE3jfEYt Mƙ+‹U ;|^_[]2UQSVWW&Y3E0AP3ۅx?Wf;Er 9w0Ar Fw7 ar;fw6WJC|tOxtXuj0Xf9u _^[]Ã&2UQVWu3Ku WXYpS3PPPPVWPPH؅t$;}VSY3ɉEQQSPVWQQHE[_^]SW3PPjSPhHt-V3jZ Q蚴YWVjSjhH^_[UEHtHu=upbLu u$=bLt$} tubLu u"2]UQe=bLt!EbLPu0tEpbLPu0؋]U SًMV3WssAuCtACA C 9;3ɋj Z 3 P肳Yt!8OExi OyE3ƉC93~HΉuEsxN GFGFG P%GMF E@ME;|_^[]VN ^à 7UVN ~'HB%jX3ɉFjZ Q赲YfEFf3ɋfH^]VhZFq6j Q?VY^UM u3%EVu;} t+ʋ t+֋^] USVM W"uu H`3ۉ]9]u3GWM 3f9tWM G$j;Yf9u܃}vGPM j;Yf9t3j Z 3 P蜱Yt!KEx KyE33ۋÃMΉFEPE]PE]PEEPEPE PS_uFE}~ u1j$YtWF v FSP)^FM 8_^[]UTE3҃d$ d$SVL$L$LWD$T$$^L$@UL$0L] }j ^Pf;tj Yf;uC9jhHL$Tl7WPYu7@j_Yf9uQAˉ)L$PP뺃d$ L$0hHj ^Pf;tj Yf;u7j[Yf9tFj_^7PYu7f90uQAˉL$0Pj ^Pf;tj Yf;uPdt$j[Yf9uqL$@hHT7?PYtQAˉ"L$@Pyt$@D$$Y[Pf8]GPf8;u ;C23ɸ(.LL$,D$(uZt$PP4YD$,Yu)L$$1t|$ ~L$$HL$3AL$,L$,D$(=1L|D$$=uM|$?d$,D$,PD$PD$PWuSj8M D$,;=uAt$0YMt!t"ttttj[\|$ D$ Et$0t$ VL$D$T$t$@4t$L$FTL$FT$$TD$0L$PF D$ D$T$L$ЋFT$TM D$;~D$C9j}}tlE0E 07m\$E7;T$}!j _C4CtB;T$|}L$Ctt$jX3@#t$E0E 0VMƉ3ۋD$L$0L$@L$P_^[]UUSVWz u?} ';~@Ct 6MVA0FYYtU;| k9} ; }xCC E3_^[] VW3Nt Q~FtuvvYY~~>~ _^UQuju uuY] UeESVWPEPuu}7GM|\UTMEt E;|j_u5&F !tuuQPWVSu Ethuc+}tRtWM #M 9$;~SQ#YPV SQM #YPSMvP QtWVW@t&t M #>u;5F tNt t M 7t M 7u]4EF JJtsJJt8t M 7V>^u4F ^t M 7>u|4>t fF UF Lt M y7ft> >t M [7t>>u4F >3_^[]UE SVWc}Y]+]} MzE uta:3F9X}+3FXC3SjvM#M$EP5MSHSVuVۨ2F9X}2FXC2SjvMM$EP4PuE t?sVSuW肨֋M$V4VMWGY@3jZC Q赧4VuW0M$3f>Wv4WYM1} tnu>΄t4 1FPMdM$EP3jMsE t E#E#j E E jPu蛧 JE tjuE#P肧fE# PjuE Pf u MM$EPH3M_^3[] U SVWM}+E xuu΋1>3F 3C9X9@M3} }0}1}tM3Mp81]uMEPE PEPuΉE u 1>}^ 0E F M0EE j_E p;vu0&F u=@j)8&4u( 3Kyu~0F &j_E @MSjutEPdE 3C9Xvu60&^ ju1@j)ȉE3uM2Nyu/^ VuEPkM/_^[]UUBABAB A BABA]UEVME FEFEF EFEF^]USVW}GFG F t@G$F$t@OV3SO V SOVSOVSOVSOVS_^[]UE3AAA AAAAA A$fAtt]UVW3hFF.J~P~ HHMV,W:~0 F4$PtH_^]VNNNfN t IujN$^t IujW.Jdw,\Hw0\HwFYGPLH.J_UEV.JtVY^]UVEtVY^]Vj8tYt V^3^USVWwVdH} _ t"w MI w MwP豢 VhH_^[]SVWwVdHG40PtH=u39_ tVhH_^[USVWsVdH{ s M s Ms P2s jsC VhH_^[]V>t 6\H&^VNN N^UWu! jujR`HPW`HPdH_]SVW32ۋO t)؄tj^OmO Iuj!w tt9OF/O$t(tO'O$Iujg$tu!w_^[USVWtM]3ɋ} t9u=u9t4E9t-jEjYY3_^[]U VW3E }}tu lHuuI>_^]Et!uuWEPVupHuSu lHuttj֋FYWhjEPjh@hKHttUjYEdU VW3E }}tjlHuuG>_^]t!uuWEPuVpHuRjlHuttj֋{YWhjEPjhhKHttUjCY EfUt]I$t]} t MhH5+3]2Ut]I$t]GMhH*3]SVWFPF P~W^S{u WSjj_^[UQeMt0}t*} t$VjEPu qu6Hu ^E]APAPQQ<3t9At@UI t]} t MhH8*3]5UI t]VMhH*3]SVWFPFP~W^ Su WSjj_^[USVWhs4VutHhɜP}C趜YYjCEPhWs,H}sVdHC M9CsOC E{EEyHK]E 0TKKBPCBs CWs轜W補M}C CQWP蠜E C VhHjEPhWs,HUuWVYWVtH_^[]UMt]UQV39N0uEPQVhqFQQhHF0^]VW~0?tSS^43StH=t>VdHh7xHh7lHhStHVhH[_^V~ utNtȉF Q~$u!tNtufF$^*^UVW};4t tQfGfFfG fF t0j莚Yt HJHJ@ B 3҉&Ffu GFf u_^]UVt tQCjYt u1 3^]Af | f/2Af| f2Afx f2USutM HNVW}j 茙Yt /3u E ff~F3V_^[] UEVf@PF4Y>^]UV$jF YtM1! 3F^]USVW7|3][t,Sj7N tEVj@47F;r_^[]UV#jF pYt u3^]UVWO#}tWW<tKW<t?jF YP|HW6XHy6\H6h&Y"_^][3ɄVf;t2^S3Cft[f;tV`uBujRV-jY"wtvF$`vFjjYQBPFP; F+B@[^4vF;vF8vF0vF;vF‹ы3ɄVNMVoY^UV!jUYt!0˖A0jpj謖YA@F ^@]USVW!jy3Yt>~~~ ~Eu EAEAEA UttQ C 3MZ_^[]U$SVWF 8HHHHt?HHt%Ht j3趕Y@3CEVUSt2ZSxEY׋I-WΕUYZujFYlS9YSMEPEPSuW蠕 MY6]jEFjEjE[SESPW`j̔Yy$F _^[]Ãy u@3Uy uE JHJHJ H MhHE]UVW^jG FYt 3E7_F^]U8SVW}ى] u2/@tG8}t)3E~w6 3vOu}j3E3YYjXPΉElHpMO%=9="==,EPWTHfM3CwS}F$|FEPW(HMVuVP舓 W$H]E@EEPW(He}j衒Yt `X 3MU@fMtWuEfMP f fE̋EEԋMEPE E}@E;|JEPW(H3C>e+e}jYt `X 3U @fE̋EEEԍE̋ PpEG;|EPW(H3Ce}j芑Yt `X 3Mj XfE̋EEԍE̋ PG;|m]N4EPW(H3CxVe~G}jYt `X 3MjXfE̋E܋EԍE̋ PG;|}W$H_^[]zFzFzFzFzFzFUSVW}$F.,$ʁFjC [YP|HW3XHy3\H3諐#Yw+C 3wwwދwًw C 3{G]EC Go]E5@K3j9wt詏Ytw蓏Yt 8sC EfEu/GEPQQ$LHEPEPEPEPEPEPTh$KP TPE̍}PEPPHE̋hH΃hHjj*t(tP,|tu&hTKjj)MEPMhHjj*MEPM뜍EP|HG U3VRVuuVPQ,Ej %Y+Ht]Ht#jC Yu袕zjC ԍYt wuω;uHGjC 蝍Yt @E;GjK wYt u3jXfEEP\HEP\H2_^[]-@w$*FjC YP|Hj YfG AHQPG0G0Gz0}Gg0jwT6XB7pG-tGbG3t90tj1YO1}jGf8w~F~F}F}F}F}F}FV~F}FM}FF@~FrFM}F~FrF}F}F}F}F}F}F}F}FF&FMF_FrFrFqFFrFFFrFrFrFڀFFF&F8F8F&F&FU(SVW u~ j*[SuwSukjX9G t'9F tfv\O_9G uX9F uSE܋PύEP֋wMMStSt2_^[]UVWejG MYt 3uΉ7_^]UQQS]VWM #cC ϋ`EtC trt>K]EEj_{  #K]{ |Ej_{  `{ HJi8uIHC QtntjQQ$YYAu+uK]C EmzK HJȅtCt?˩u+t#tC 7K8y8tft^M @QQ$4QQ$R$ ]=Ej_{ tO]{ 2M QQ$QQ$]C EotUEuKfuFPKz2{`KAuˋC 3{M p_^[]UQQVW3 u=QQ$YYt{+-ȉUMm]EDzX u  uCW t2t |s_^]Ãy u3V~ t^@ËA ~~t u@Ë3ËA $tHtHtHtHu"A@EjjXà tHHt Ht3Ë@ Ë3@ 1LunLnL 3ȋ%X:3ȋ%3ȋ3UQQ 1LunLnL 3ȋ%X:3ȋ%3ȋ3EEyHK]E K]V3 0eLF0eL֋3ielBAnL|51L5eL^Ã=eLVW0eLujjY1Lp5nLV$ȋ3%߰3343OuпV$ȋ3%߰33t32OuЋ 0eL$Ћ_3%߰33t3‰^UQW} Mt@SVq~,3ɋE3û3ҍA;|ًM1^[_]SVWhd$4P$X\_^]V\tv PjT\^UQQVjYP.?]9Mu 39M@^]UESVWj[~iS3A+ȉ RKu!FLjDWPF ]~jDWPN~j _ Ou_^[]UVWj tOj t|jtXyOyGD;GLujDj$X+PGP u_t7HtuEyHK]E K3 ?Eu ?EuE%HJ_^]V&؋ 8K"^=|U$VW@u$x39u v}QQ$0>F;u r_^] U츸އSVW33ىTh]ԉX\`dhlptfxf}{YPMetWs33FuhKuXYYQˍ\Pu$dPLPTPEPu ®EPlPpTPlP.dPLPTPEP\Pw$LPlPdPlPlwtjbE 3E VVEP.3EVjP3E5VEEjP3EVjP3E5VE܍EjPػ3EċVjPȻ3EVjP踻3EVjP註LPtLh|KP۾EYYuj Ctw$PUυ;~+3ȉEPVuM̋/E}Ѕ~(]uQQt03F;|]3EF3PuM9uuVu:M̃U;wuuaY9utLPHj }3TfxfLhPxXP\`dpt}hlu T 3fVTt9LPHj %u LWVPHuLPHj_LPHEPEPVZM_^[] USVW33ɉ}Q3ۉwC7M؋ff]QxPuXtjXC7ESSP7ESjP7]EjjP3E73ƋujjEPθM}jj1葸6YSEuYΉE6jSP蒸Nw$QSu}S]MSu;}tV讖YS觖Yj ,}u_3ɉ3ff@M؍S<V4E Y03_^[] U(SVWE33EjjP買hjEPEEhKPYY3EFjjPˉuqu3ˍ<6WjPR?PWP<33jf=EjP#u3 <6Wju yu PWVu3f7P#YYtohKuuYYutU3GWW3莶3EWjP褶E5EWP3eE2E<jX_^[] 3UVjhjjjh@uHtuju VHV\H^] UPhLHujhtKPPH]UdSVW3WW6豵63ۍECSj@PĵWu6葵Sj6腵6ESjP蛵6}Sj`P脵 f9u Sj6DSh65k(S(W6$6EċSj(P:EԋEjP6_^[]UVhu,P跦 3f4^]UESVH@FtdjZ;rЉV 3ɋjZ Qes3ۉFY9^v?WjRsYtEH gQ3FtfWrYVrY_^VVqY^U\ |=RLSVW5HSPjf5xRL֍PMQSPjr5xRL֍PM0R&R]RE]M܋EPV]tu܋uVhKP蚙hKP聙uMPtSMrh+IMeMhKMqhKMCEPMh+IM*hLKMEPM=RLt>}tuSuVuhKٞ5uhĈK軞huu5RLH3LJ8MH%q@|RLMۺMӺM˺Mú_^[]U\ z=RLSVW5HSPjf5xRL֍PM?SPu5xRL֍PMRR[RE[M̋|EPV[tűuVhKP臗hKPnuMPtSM_h+IMRM} |}tuSuVuhK跜5uhĈK虜huu5RLH3@tEMܣ|RLøM軸M賸M諸M裸_^[]U xV33} VfhPVu @HPu VhHMP#E^]UExp;}PnM 0 M 2]UVuMEPM۷^]UVW3j 9~uqlYt uO>"WlYt u5FGFxF~_^]UVW}QAtBtP;u;NuVQf'N_^]UM u}tujhguH3]UDwEPPhu`H/SPhKPbP躉؃f]\uf]:t 3f]W3Wu $Hu 8EWh jWWh@u HhjP)Džf f hPPȝ M3҃ fRQRRPPh WTHWu\Hu (H3 \H3@_[] U4SVW}G0NAD$4AD$8A D$<\$0GpND$AD$AD$A L$D$t$t$HKL$gKt VL$ĉKL$fu֍L$fSHhԆKL$$D$0PL$$hЉKL$$Z=H3SSSt$,ׅuchKL$$XD$PL$$h$KL$$SSSt$,ׅtu F h0KL$$SSSt$,u F L$ u &F L$L$0_^3[]UQS]VWE{rCHtECpF8C0FuYuu E&F _^3[]UEV@0Nuu &F 3^]ULSVW}L$GD$G0GFL$H03D$j\$\$$\$(\$,\$0\$4\$8H9\$LcL$HRL$Hژ|$v-GHtD$GH$$D$t$L$D$4t$PD$4PD$0Pt$\LMu 8\$M jjWL$,D$D L$8L$$L$<\$@SjPWD$TL$8D$(D$8D$,jD$@D$D$ D$$G G%} T$3@SG PHpVHL$H7_^[]UQS]VWE{rCHEtECp+F8C0Fu蕤Yuu &F _^3[]USVu2ۃ~rFHtËF0N蜨uu +&F ^3[]USVW3M hH\$8E@0]ND$AD$AD$A L$D$Lt$t$H0KL$atjcl8KL$atjVPKL$atj@dKL$atj*pKL$latjKL$Vatj^KL$?a 3jaD$L[D$ SL$ hKL$t$H;t cu(t#hHL$/t$t$踃YGD$YCz~M O3QFVS\$d$4D$,jVPS|$0F8CpFjW0H} G 7|ul@H=u_}tYCpSF0HC0F dHE@0,L$F0QRPvE@pL$F0QR$vE@p L$F0QR,vE@pL$F0QRv!E@pL$Fj0QRDUBptcFL$00D$PD$PD$PD$PD$,PD$DPDL$0Xt=L$ tj_D$ t|$tuuD$ |$WPQ4U\$v/Bp΋XFˋ0D$8PVt$WD\$vE@H D$0Pt$V@x u跚tQ_^3[]USVW}ًG0NVEBEBEB EvGH&u U+UbE<uM EP'G0vM jjHŢM蔖_^3[]UESVW@3S0EP2t/Eu ΋@xXF >^ 3SGWHRu ~ _^3[]USVW}ًG0*VEBEBEB EvGHu UU袄tEPjjHG0vM Mx_^3[]ULESVW@0VL$8jjjKD$DBD$HBD$LB jjD$Xt$PSs-;u SL$<詸M hH3SjH L$8xS`HD$ Ph+IjShl-IHH_D$ T$$Rh<,IP:D$$St$<PRM _^3[]UET@SVW0FFL$Q0Hu$u &3@jF PH'PHu 3\$, |$0{F >^_^3[]US]VL$XWC30F$Q0Hȃ $D$L$D$P$D$T$D$X$D$D$QD$LH{v CHDOt1OtD$DPPHD$$PD$H,D$TPPHD$$PD$XD$LPPHD$$PD$PPH{v]CH3C;uND$0PD$2PD$4PD$6PD$6PD$8PD$xh$KPnM $ P3CM jSVL$0D$lQhKPmD$`L$4PPL$jSD$PVL$L$4D$& KPD$dWPlm D$`L$4P褴PL$CSSD$PVL$`L$4蛏D$*PD$dWPm D$`L$4PVPL$jSD$PV=L$L$4LD$,PD$dWPl D$`L$4PPL$jSD$PVL$L$4D$.PD$dWPl D$`L$4P踳PL$WjSD$PVL$sL$4讎D$0PD$dWP1l D$`L$4PiPL$jSD$PVPL$$L$4_!M hHT$\jjHe_^3[]US]VWM{uHCp8F8C0'FWyyY<uM Pc8hHW jYYM uhĆKhHC0 vL$$HL$Vu2PL$VL$ZC0vL$ŮCpvL$,ųL$(}t/D$,L$(HPTf8\tu 3F  CplVL$3St$kYY@j$߀t@j$ǀt(3SPH/u F L$HL$hL$X L$8CpND$8PD$PD$`PT$t x L$3PU3f9u-QL$t$L$L蚬L$Hh؍L$H襇tVG \$L$uwL$8nL$(eMXL$8OL$(Fuj8;Yt ҅D$3ɉL$F0KSv\$u4@HT$jPH +tQ薆\$3t8tF;rj ;u7S;D$YtH D$D$d$D$P;));D$YtH 輣L$3ɋL$ HFG _^3[]UEjpu P]U$SVu WE3F >@x uXj8j:Yt NE@0hv~uJtQ2jjH蕑WPD$P!uW؋D$ xu hL$$?3D$hHD$D$D$D$ P蓀tD$ PL$ik|$u!&F jjHD$Pjt$H(E@x utQFL$kL$ ~_^3[]U,EVW@0NP qP/WYY3EfE3}jTEXfEEP}}}}Htu F >_3^]UM3V9AtA0FjPjHtu \&F 3^]UEjpu P]UPESVH@M3ɉMW0}FEE@peFM hHE3P`H}ur6FH8tj@_FH&t@FHtM0ErFp FM0sErE@H°E3ɍEPQQMHu3f9t=EPHu/%M3PEP3PVPPQR Vl7EYPQEPhKj3Ph|-IHH5,H3WjH+EU}RPQ(ME PQR$EuPQh KPDYYt'Puuu ut8h K׍PVHuVH_^[]VH23U\SVW=HPuM2׋t\hHPDYYt3h KPDYYtuU *RYPVHuVH}PhK׋ty=H]tUhHPCYYt>h KPtCYYt'Puuu ut8h K׍PVHuVH_^[]VH23UVuWFx uZj8ZYt >e3F0轥jvpeuPtQ$fu &F :jPD$Pt֋D$ xG(u뼋uFp~ b4}vtrFt'HPD$蠆f8 tXt$ 菆f8 tGFL$PφVL$hKL$LD$P>AL$D$ eD$ 2V#A(膓MЋII蹓VR@;t2uu &F E@x uhtQd_3^] U|SVWuMMԉEME܋EEEEEhKEwPuHEu}MJo u j |HhHP@YYh KP@YYEPM荋PMt>}tV}tNhHM蹇uMuVWu u؄tA#U 3 J}tWPuH 2ۋEPHMcMc_^[]UVWM 蹥pE0x3M jt';}tEt9u2_^] Uu uj q]Uu uj]]Uu ujI]Uu uj5]Uu uj !]Uu uj ]Uu uj]Uu uj]Uu uj]Uu uj]Uu uj]Uu uj]Uu uj]Uu ujm]Uu ujY]Uu ujE]Uu uj1]Uu uj]Uu uj ]Uu uj]Uu uj]Uu uj]Uu uj]Uu uj ]Uu uj ]Uu uj}]Uu uji]Uu ujU]UEMVQ@-PȄu ΄t蝠EF 芠&F 3^]UEVW@P-u U>3_F ^]UQSVuW^t F蟢vNI荢uPjD$PW|$ tM V轡VKYu ҟF >_^3[]U 1 SVu3W3ۉME~vFH ؋Ev FHRUfNRUR1UIRURSPáP軡P\u*u +U3&G~ jWH}kM 3G;uP͠SWVnMEejWPVM}M蹞EeWEEWPV}M蕞uJEejEEWPV}薔MkEejEEWPV}qMF_^3[]U4ESV3ۋ@W]p΃~ u3@EEPe~*jXEsNE܋AEAEA M܉EEAEAEA EEtM܉E]EtM]EP2u'u 臝F SjHiRH~SjHiu I&EQMQ@诟Pu !>F MT]_^[]UQQSVu3W~OMy u@_ ]{ uHHtJH/C8FpFWER@H0 PP/CFRHp8۞PӞP˞Pa蹛MAM8Fp覞PW蝞P蕞P+wˋ?聞MPxPpPhPu ڛ>F _^3[]USVu3CW3]}}9^vFMpEPy(FP蚈u lM^ >__^3[]UESVً@WH0踝P谝P賈yjWHx3Gu >3_F ^[]UESVً@WH0\PTPcyjWH3Gu 讚>3_F ^[]UEVW@H0PPEu m>3_F ^]U $VWw}vGp誙vL$ 讁Gp葙Ft$GQ肜Pu L$F >&Z_3^]UVuW3~v FH.N -PjWjjjjR,u 蔙>3_F ^]UVuW3~v FHهNj ֛PWjjjj+u ?>3_F ^]USVuMW~v] ˃ME#C vFHdEv$F@E x uzAE MpCvFH (EvFHVJ2]QQ$uuuWP ˋ`C 3MX_^3[]Ud$ SVW}\$D$wv GH 芚؃vOqL$tD$ Pa腘GpOFSGQCPBu 赗L$F >裗_^3[]UVu3W~v FHVPJ2PP蔕u U>3_F ^]U8ESVW@3M}p΃~ uE3PCpw'j[聖NE؋AE܋AEA M؉EEAEAEA Et M؃WtMV]EPDu%u 虖3>@WF PHb-EMQ@PXu [3>@F 3MV_^[]UQSVuW}߃~vFH藘E~v FH 胘~v NIp؋VuWJ2S\PTPu ƕ>3_F ^[]UVuW~v FHNP PMu y>3_F ^]UEVW@H0ϗPǗP衖u 9>3_F ^]UVuW~v FH舗VPJ2zPrP膜u >3_F ^]U SVW}3ۉ]]]wr%Gj)@ȉE0u] Cr!Gj)@ ȉEu MEr1Oj)quƖ$EGH趖$EGp蝓uFuuGSQ舖Pu >3_F ^[]UM39Av A@VWP\u 軓>3_F ^]UeSVu W蟍jjWE xv @EMQMQMQMQM QP-E 33ۉEVCuSE]PWKM ESEESPWu](MEjEESPWu]MْEjEESPWu]M赒EjEESPWu]輈M葒舒&3@jF PH^_^3[]U4SVMWo3=WLtE̹WLP_t}]hHMЉ})u߉}}]}=WLujjHc^Ex@[M ܋jjVRM3e@jPEEPVMŇM蚑EejEEjPVE蛇MpEejEEjPVEqMFeE]3jCSPV]LM!eEjSPV}]*Mu EF M#Q_^3[]UeSVu WɊjjW?E xv @ EPEPE PLtME 33ۉEVCuSE]PW腆MZESEESPWu]bM73jGWH\&~ _^3[]U8ESVW@3M}p΃~ uE3PC7p'j[HNE؋AE܋AEA M؉EqEAEA uEt M؃OtMOt7]EPu%u \3>@WF PH[-EMQ@謑PPu 3>@F 3MPO_^[]U,SVuW3lj|$ ~vFHJ}D$ N{ t PWW~~ ZjHj܂3ɋjZ|$ Qm3t$ D$YjPjjSӂ辍Njt$D$0AD$4AD$8A jjSD$H藂艐D$PD$PD$PD$PD$4PD$_^3[]USVuW]~v FH莏؃vNI |Ev NI^{3VPuJ2SSPKP u 轌>3_F ^[]UQSVW}3E]wt GEv OI؃v OIzEPSu_^3[]USVuMW~i] 3MEE#C vFHvEvFHy NzEv!FX { ut9sM>s] vFH EvFH N XEQQ$PuEuPW\ˋ^C 3MK_^3[]UVuW3~v FHyN1萊NPPWPjP1u >3_F ^]USVu3W~v FH:y؃~v FH2N1NjjSW1jjFu 舊>3_F ^[]USVu3W~v FHx؃~v FHNSW 貌P転u $>3_F ^[]UE39Hv @lxȃ=WLuVu &F ^ QWLs 3]UVuW~v FH'N xWPu 茉>3_F ^]U_^]UUffBABAB A BABABABAB A B$A$B(A(B,A,B0A0]V`N`N `N0`N@`NP`N``^VH/JvYY^V\HNXNDN4CN ^BVN`BNPBN@BN0BN BNB^BUVlEtVY^]UVWxNItq8QI΅uEtWY_^]VW>tWgYV`Y_^USVW3ߋNtVRXIuMS_ȋ߉M9~v)Fp0P"F MxC;^r_^[]VW39>t 6\H>WWjWH3ɉ_^U} VtuuS^TW}jjwpGxw0w PwvHjuhᆳj eShw`PHu Phᆳj/E PWHU 3 3 ЉNV8Et W jPPl ؅tWH_[^] U$SV3WSFT%PSSv vH΅u Shᆳj)yuWM SSSSWHtWWR=uJE]PEE PEPjWH3fEEPYΉFV8] tW# jSS Shᆳj* ؅tWH_^[]UUD 3]U|SVWM`EPw a ujhᆳjB |utt jhᆳjVsu jhᆳjNt,NNt jhᆳjuGXPPEPvuPPEPMB_^[]U eEePEEPEPh uHtE]U$S]VW{twTuu uCxjjsps0s PswHuPhᆳj  3QVQQQs`QPHu Phᆳj } t SV Et,j[E]PE PjVHM E SPjVH3SSSSVHtWV=uJE ] PEE PEPjVH3fEEPnYωGW8]tVjSS Shᆳj 3 ؅tVH_^[] UU 3]USVWyxM W~]j)C0诀u(|FxtC0x|v~d hI__^3[]UQQEVW@FNMt69uEPN M EuzEPMAKMƋM Euz_3^]US]3VWL${vCH~D$ 3D$ {v KI \~D$Cp{F8C0~{Fx$̋0C$CP$$$WVPK L$sj 3WpHHWpH\$t D$ Hx L$ u Y{D$ F ~u L$Q _^3[]UQQS]VW{uIG3ۉEt%j uCEPMIE׋u zF CG}wEu9tEPMXIuEڅ{v CH|} yt u?3jjW} qjjjX@ WEn/zEjYO GjjQX@u EnyEG Gj} EujjjWJnx_EujjjW'nwjjjXW ny3AjO Qju xm)3+tfHtYHt8Ht,HtHtRjvxxu /yF >nRM EuBwGxXxX u xF >^jjH0EM hHz_^3[]USVuW\$ ~vFHz3F0wFx̋0CPLjWhHV$bjL$u ΋|$ \$$+x^\$ F >jt$,HvDjt$0HXL$_^3[]USVuW~vFH:z3ۋF0#wFx̋0GPjSH$SVjL$$T|$8t/jt$"Yt uFGFxF~_^]UVWF 9FuLsjX3ɉF jZ Q.~YtFtPvWv~jYtU JO3NF4Y_^3[]UEVW@0!nFu ΋8n>3_F ^]UEM @0rM _M3]US]VWCECp3F9uvK p#F;uru &n>3_F ^[]UEVW@~pu m>3_F ^]US]VWCECFp3F9uvK 1p F;uru m>3_F ^[]U USVW3MF3ۃzj_uBHMy u [)t{lMA9tiE@plFBtFHHt>t@ t8HHt0t2u mU3@SF PH[9j j_uUzruFHAoUJ 2oE }#؉]yx+;}uu lEk3ۋ+CKM΃ }#3@H# U #E E }3@+ÍXӋu -lU#]J# E3F _^[]UVuWFHinN9IxXnϋOnBn7nu k>3_F ^]US]VWCECm3F9uvK m3F;uru Zk>3_F ^[]UEV@ nQQ$;u ]kEjF +nRPEP PnoMj3^]UE@VGmu(MfHjM,M EP%lM*i=~M hHcljjH6C=}M fE3fE EP4l$EME $&M VlVY3^]UE@Vlu(MGjM,M EPqkM1*9M =~hHkjjH46fE3fE EPk3^]US]VMWC30ivUjxYuUWjH5{v}CHkHtIHtAHuFjuEuP)ZlMEU&iu iEF `j_3GWuEuPM PimMh5~u vhEEF FhEF _^3[]UQQEV@hkQQ$-u ]vhE3F ^]UEV@%kQQ$7u ]3hEjF DkRPEPPlMh3^]UVuWFWVPHHt!FBVu gF >$u g&F jjH4_3^]UE@x ux tVu jg&F ^3]UE@x ux tVu 5g&F ^3]UQQESVW@0~ u6} g'3CΉ_ .tC~ u=iҁEΉUm]E]iED{ f_ _^3[]UE@y u y VWuTPHHt3G3u df>3_F ^]UQQESVW@8 u?u 1f&3Cω^ -tH9_ t7 t1hEωUm]E]hEDz e^ _^3[]UE@x ux tVu e&F ^3]UE@y u A-uVu ne&F ^3]UE@x ux tVu 9e&F ^3]UE@x ux tVu e&F ^3]UQQEV@gQQ$*u ]dE3F ^]UQQSVu3CWN9X u@I9Y u8gt/N1If΋fu ΋cd^ >~qftUOeftIO]g t=NILgˋAgVWRPR} ϋdG 7_?FH0fQQ$fQQ$s2u ]cEF _^3[]UEVW@ Ru c>3_F ^]US]VWE{uCHeuE} Hc'3BW C6;;>Kx Iy }tkveKE ieM E;ubEG +;}_~[}CQubG 7geC]ZeUEDzwAzjjQEEPjRH.UCeUDz؋b%t*QM Q]aEG _^3[]UE@DdMQ3]UQQEV@dQQ$0u ]aE3F ^]UEV@0`vM b3^]UQQEV@dQQ$G,u ]'aE3F ^]UE3SVu3CV^ +t-Ht`E EF FQ`E ^ B]W} ρ;wrw`F `F ^>_^[]USVٍMW} y3;~uCPSWV`?CPCPWPL?CPCPWV:?_^[]VNDV N4N N$^E U$SVuW_3F SKL$ v=uD$$Pu utxD$D$xHPt$$\$S\$$\$()|$vC0u\$uD$PD$PSytVPtVBL$3_F ^[]Uld$d$ SVW}D$G0[ND$ AD$$AD$(A L$ D$,At$$t$$|HL$@h،KL$4Ad$D$0QPL$H$u'D$ PL$DjD$ PL$HD$D$L$0|$t'u [&3@jF PH'uCGH]t3Ft$GH]tj^GH]$ D$t$VD$PD$(PFȅu 8D$tVPGpD$,PFAjjD$t&jjH;'u Z&F  Gp)_L$@L$@L$ _^3[]UQQhnYPMhu5RLlHuM '\EuPuYY3]UEV@0YF05RLH3^]USVuWE~t F[\Ev NIH\SuH_^3[]UEVW@!\uPjHu Y>3_F ^]UE@[RL3]U4S] VWhHt$$[5RLH=Hj ׅtTj HuHjjHe%WHu HjjPZWH[jׅtWjHtWHtPL$gD$(PL$f?PZL$(WHL$jׅjH=WHTL$53PPjWD$HH~A\$ hD$3_F ^]UQQVWhYPM}3fE@0vUFhW0HM EP1EuPAW;YY_3^]US]VW{CrpUF8C0 UW 0UjF0Hu qU>3_F ^[]UQSWE3Ph:CShXKjjhtHu!Vu 'U&^ jSH!^_3[]UEeVW@0aTVMEBEBEB EU:uu|HEPwjtEPEP@M PYjH M hHPVM_3^]UESV3D$ xH@W\$\$\$0RLSFL$Q0Sx-|$v&ju D$\$PD$PYxRL"SjRLHC M hHUL$1_^3[]UE@VW8 u EP3$ u1M)1EP3Pw[EM PTMM hH$UjjH_3^]UtSVW}ٍL$ \$wt$Uyd$F@$>IGGH$[AD$Oj)q eVuHUD$D$uXK\$8Gj)p,Vt L$0 UD$,Gj)pVtL$0@ TD$(GHTx Gj)pUu TD$$L$0 GHTx Gj)pUu TD$ L$0Gj)p wUt,3fD$@Gj)p]UL$T6")QF0ftNj7 uft$@D$ Gp PFL$ Hft09~Mt mL$0vGp PF\$ X0D$Gp PFDXPYt#GCp qPF XkD$ 뷋D$\$ \$D$4D$ ?jjH)M hHRPvL$X8Gj)pTt L$dG5OvL$h7Gj)0St P OvL$H7|$wL$0T$,Qt$(L$0t$(z uPj_3^]UE@x u@ Vu ΃ u dNuRN3@F CN&F 3^]UEV@0~ u6j)Qtu N3@F .j*Qu ΄t MM&F 3^]UQQEVW@y u @x uy u. URPtu MEEF F"u fM&3@jF PH_3^]UQESVWxM{ u u?u M&3@F { u W3t#L3@F UjPHD_^3[]UE@VWy u 3D$Hy |$ |$|$u D$P9|$uWjHM D$Ps(L$_3^]UQESVWxM{ u u?u #L&3@F { u Wt#L3@F UjPHR_^3[]USVW}L$GD$D$ PHD$ 3ۉD$D$$D$GD$ 0KF3uu wKF 9t$u+u VKT$F SjHrmGj)@ȉD$ Nu L$MD$Gj)@ȉD$ Nu L$kMD$Gj)HlNtOj)I[Nu3CrGH 2MD$ ~~r GHMۋ\$tjPt$t$$]"|$ ~HG0IN G0IN L$ u_^3[]US]VL$ WC0zIFuu I&F CHMLCH@LD$CH 1LD$CH"L{D$r CH LL$jWt$V\!}tj_C0HN t$jWt$ t$(!C0HN L$ _^3[]UEV@0cHFIuu H&F 3^]UTSV5,H3hShSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSE։EEPEHuu GF 6EWt;DtG~u GF G_^3[]U SVWEPH4HPEPNE})EE)EuaM _A3ۋjCSV>MEejSPVM]I=MGEeSEESPV]%=MFfGujjHEDKIuu ΋}FF !G'I3C;uu ΋}F^ >_^3[]UVuW~u FHHVjPJ2HPHP'_3^]UEV@0EFuu F&F 3^]UQEW3MGxr@HbH~SES3V~F@0@EF~tE 1EC;|u E&F ^[3_]U0SVW}MGEGpDNEEЋAEԋAE؋A EGpDN3ۋEEAEEAEA EGGt#Gj)0HufGOj)I_HtEMPC,EЉE@9EvjPM )EE}r GH2؃rLOj)y Hu9@G0KAu IJ _UPVu VuuSHu DM>F OMG_^3[]UKL$ _^3[]UEVC Y_^3[]U SVuWM~r#FH,PHHt FH,4H؋F@NI@ESPE}uj(HVWPE Hu ؋=u F  j$H_^3[]UPSVuW]ЋF@NEI?NEI?NEEI ?~EEr#NI+PHHt FH+4HEWP~r FH?~FHs?EE~rFHV?3ɋFQHD?PM@u;uEE;EE+EP\+u@VEOYY2ɍpM E؉uPEPWE,M3ۋEډEU;]lj}܉EE };uEMPE +jYM 6jjPE|3 }t}+}+}jjjuF0;3ɉ>A}N t}}+}QQju0;>}F uME 4u4UUًuԄu走YM u%] 7;U3#@jC PH_^3[]UEjpP]UEjpP]U=RLSW}_GV@=3x,G0=e}GV =Ph5RLHrdGp9F3ɋf9t#Gp9F03Pj 5RLHv#Gp9F03Pj 5RLH^_3[]UVuW~Fu*H~3_F ^]UE@VWn:jl΍PW5~jjWHu 7> u 7_F 3^]UEV@:PHtjHPHEEuM 53^]UE@SVً0Wx6v9PVEPuu 7jjjHujHPHEăel5HtEEPh~fWjEPW Ht4H=3'ujlPW WHYeEPh~fW֋u Q6>_F 3^[]USVuWE~vFH8EV2΋z|5vw8PVEPttjjjHujHPH/JjEPWHtuWHuu 5>)jHPHWHu l5_F 3^[]U$VWM=E@04EPvuHu#PHPHvM hH6B@ j0EPj uHPM>EPMM P<6MM_3^]U0SVuWF7V؉]J6M hHD6juSHlPSFP#YPM]jVSuHtmExr@Hl6u?S3bY;u0SMBEPMM P;5MM=M VSVP 'jjHjHPHM_^3[]USVuWF5VJ!NЋI!jPRWHu 3F u&jHPH`>_^3[]UQVWHjWJ4M Eu0_3^]UVWD$PhHjVJM D$ t$ 0_3^]URLS]D$ VD$ CD$D$W0΋{1Fj?0$<P3 f$Cpe1Fh0$8P3 f$.CH;4i$0vCH 4$$D$PjH_^3[]UE@SVً0Wx0v3PVEPuu 71F jjjHM u+jjW( u4jHPHSj3CSjWX%0^ jEPVHjuHPH VH3CSjW %0SSjW^ є$`0E^ ]C0/vjjjW$1Cp/vjjjW$1_^3[]UESVW@ًx tu /F 3W>j3x u0WjjV3$uu /3@F ċ2=єtu /3>@WF j;jjjV#1PHu ΅t#J/3>@WF HPH '/3@F _^3[]USVM W)3ۋjCSW& jjjHE u7jHPH9jSjWA#.^ ]{vJCH1t;jEEPj hu HtjHPH3CjjjW"?.3є@PPjWF ".E F C0|-vjjjWv"h/CpV-vjjjWP"B/_^3[]UTS]VWCH0M hHD$e/K y tjjH}3ۃy u9SjjW!uSʋ/=єtSjjjjW!D$ /D$3|$:fD$8jfuSxjdD$`PSC|$GPǡYPL$ 4D$XPSHD$PD$j3~ u6u}WjjVu u *뽋,=єtu e*WF >jjjjV)vjjju,PVEPuu *jjjupb,EHI+ЋEHI^jMQWPRV Hu ΉEu$)WF >HPH)EF _^3[]UE@@ Hwp$oGh Kgh,K`h8KYhHKRhXKKhdKDhxK=hK6hK/hK(hK!hKhЍKhK hKhKM *3]soGzoGoGoGoGoGoGoGoGoGoGoGoGoGoGUE M:r E:w3@3] UVuBPBPPt.BPBPFPtBPFRPt3@3^]U,SVW4HPD$PuD$(} t$|$PDHPHFu|$0XG|$4xu&VVWShH}tj Y!_^[]~d~j ^D$ PHiD$ L$0IL$4@D$iD$$I@D$D$PD$Pj Vtjjt$t$ hHj YUQQE 3ҋMBSVuƉEEW3ME] ;s_FFu ;ur]t;]rҋkk;]r;r +k;r+ ʉMEyHK_]E^[]UQQE SVuƉEE]WEEE F3F3UK33UK33UK;ur} ;}r҉UEyHK_]E^[]UHSVu WMF;‹N ~;ψ]Lj}tVtN~ uEPE4MNEF F~^ +>+^GCj](HSWPEHuEHuEPHuˉEtيUDŽt؄t^ ^] ]tVuh QPu RuSWjjVHE(؉}E3j 3M@fEXQfEƍEPQQQuV5H֋EMQbYjEPWS]juSuSHuHSHuj$Ht W荙Y3_^[] USVEMԉu ERLtP"ErKI+"EKI"twCH"}ȉMu)t PEt E}$#Eut Et 5Eu}Mu E++E}uE+E+EuEQjjPHVjuEPHC08F5 H3PPP5RLE+EPE+EPuuuQhlHu֍MԣRLQP4HM܋E+M+E؃};3WWW5RL}PQWWhPWhHW֋KEЋqNWWjWWh1H؃WSHVjHWHjMQVPSHWHS\Hu WHEPjWTHE3Ph,ISSu`HEPQWHMIU RQP h SSSu HE EPQu uShrVHE RLE+Ej PE+EPSSSVHECMpF3VVV5RLuuj j W0hHV HVVVhpK}HjHPVHHPj@VHjZVHVEH} r=KqF0迯Yr CpF0HP[YY} rCH |CH j ^} r.KI$xCH$= CH$HQ3QjQjjQQQPEQQQjYPHjPj0WRLHE tlW(H5RLSHMIq VEPˋYWSHuSV$HE+EjuЙu+ Pj VHj5RLH_^3[] USVW}jXMfEPu CuHM>uM K tjj#M_A=wQHfGjjH2_^[] UQQES] VuW#CEi+iEEP3P8EtSPPSPHu 8Et4PhL' ~SuHuj^PV jHPH_^[]US]3WPP{GW3jPHEu M >V3jZ Q輎YuVW3jjHM HPjV2V Y^_[]U}Vu QQ萲TuYN F~$BmF@PPFCYPF@Pu6豎 ^]UVMuV E^]UVW}QAtBtP;u;NuVQ'N_^]US]3WPP{PPGW3PPHEu M 1VP苍Y3PPuVW3PPHHPQM VVٍY^_[]UE@y u uVu >&F ^3]UDS] VW3ˉt$|$ WC ;|$`HudHD$ P|H|$(|$,}j XfD$ GHHHtlHGp FD$GpFGpF8E@0u t$SFL$W03GXc˄~:GH;!GHt$D\$ t$d$j<ދD$ YtHOj)q^t3 8FG0't$FL$ S0ISt$3D$(@x!M D$ j[Pd$HL$@P d$8jD$[D$0D$<t L$0@CGpF8E@0u Ft$jSW0Gp[F8E@0GSjjdj<赊Yt"O1#Njj1HRt$3D$(@x!M D$ 3PCd$HL$@P d$8jD$[D$0D$<t L$0?t L$@1D$yjjjP!D$ P\H_^3[]ULSVW}ًG0_FD$GpIF3Vt$(D$D$$`HudHt$v'Gj)p !tD$ D$3L$T$8VYxJD$t$Ph+IjVD$HPHHyVhKVj>Wt$D$/Gu PhKPjċO tVP|$tkD$HPt$$LHy|$tVPjhKjjyd$L$QL$LQVy|$tVPjhKjDVPt$v%Gj)pt3F\$$D$(P|Hd$0d$4j XfD$(uD$"j(Yt38L$QSt$SD$0d$0M D$(PD$(P\H3_^[]ULSVW3M hH|$D$(P|Huj XfD$(F|$0|$4ʉT$A ~s Wh8KWjzjPZD$YtW~vNqFuD$|$FpE@PSt$vQL$(AϋqyQPWWWV L$0JD$HD$AD$AD$ A L$D$$5t$t$|HpKL$U~u/9||xM DPFHL$y u3@D$D$HP4jXD$D$HD$8AD$PEPMjV뺃jhKjj_^[]UES3EVu@E]ԉ]؉]܉]]]W}aE 9VXujh\KSjEjX9F uË@Eu jhKSjՋuMQȉ Yy jS3@f9EuMUEt? PQ6M x&t f9uEuEu3FjZƉujZ 3 PqYt'P0EHUxOy}UӉ]Et/ڋEˋ@4F;r}3ۋEU t}ˉMtt}rjEZf9uKV\HM@ff;uhHxHME̍ẺFGjZx EtvAM;r}E E܋EEt EEE؍EP|Hj ESPkMU }RURtSURURuVh,,IuQP=u<}uMU}jYW3}f9M WS}WPVh,,IuRQ}y& ;u jSEPQjSSPSSHEPE .EtjMyE@x uG t,$@f;t,u@ujYf9ux uWF;urEP\HEtQ;3@PhKSP_^[]UVuW>tQhHjj*MEP}uuu VtjjMȹ_^]U eEeUEEVt&BtJLtRu EuPj Ru EuPjM ^] U8U3SVu ًR3ɉMMMM̉MԋExHEfEWA@ EjG^f}f9pu tD@ Pjo A3UB AGt.Ht$7u'BD@ PjotOGQM밋EMj_fEEPf}qE3u f9xt[WjVVE̋PE PEPUx>MEPUM fx@uDjZf9PUt5AM jYf9HuMM耼M_^[] @ Pjn VW~ tNytQKX~F ~tF NytQ(X~F _^USVj[F 9FuM jX;r3ɉF W Qk~YtFtPvWflv莌~_SkYt M 3ҋNFF^[]US]VWxHCFtZjZ;rЉV 3ɋjZ Qfk3FY9~v5j TkYtK43ɋF G;~rf f_^[]UVuWOFGFGF G FPwF PO k_^]U$E3SVW3EHA}}}9H@x ux 9 WQQS NEAEAEA MEuu|HKMggtH3Fj;}VjjSMPHFًU EMEP%M> M4M製_^[]U S]Vu WC} 3Ef9Au9,uuVSE EoLu"dLhHoLhεCYKjZj3UZjf9PZ_uMQPEuhhdLuKjNE Zf9Qu#M QQPVS* E EKfxABjNH MYf9HuwMy t(BE PPQVS!E Eu6S)E~ȍ3}jPuVS'ti"uRSp)xWjuVSxaK@f;Et3f@u6Bj3Zf9PjZC@ PR__^[] Cʋ@ PjXPujn֋Cʋ@ PhEC@ PthhUE8@SًM VWBfxt@ Pjr}\339uM=UPMU}t%}tEԋ@TMM븍MM39uM E @@ Php3PPWt3@f9putHtHtHtHuхt IʅuAB_^[] UQQS]VW} MMSRAQj@ EM3F93~j7uVsMF;3|u"~ u3ɋ393~}4ZF;3|} jQnYYuuMhR3_^[]U S] 3Vu3W[jN]EOxNEf9Xt@ PjrM5_^[]MMu3ۅ~܍\>tCO8t O8t N8uCNM @@N;]|jh?{ULSV33W]@]M]]E5Ou EHEEEEPH ЉU}I3Jf9pu uŋHt#Ht HHuK맅uIEMM딅u8]uA3EEf9Hu8u jUYEPEPRUME@fxu0EE"CE@@ Pjr<}t&EtEP\M}EuEEjhM/M'_^[]US3VWE3ɉEAEĉE̡oL}MЄu! dLhHoLhĵCP~Yu ]CA3f9Bu7t"HHtHt B PjjZA3BB Pjn U=bLU ujZuBU Kj3_Ef9x}iREMQPE4j jDP4DMPj.MUCM0MExbLPEP_Eu4juEhdLPExbLPEP3E|Eu hPuM轨CjNYf9Hu3EPDPEPVS MuMEPMCfxABSz }}t VSjNYf9JuqMy t HEPDPQVS_u6SM~ 3D}jDPuVSE3uPSjEċPVS;x]MEPK@f;Etuf@u@Bj3Zf9PuGU C@ PjyM@6ujn(C@ PhC@ PuNM_^[] U|SVW33Ɉ]A]MMM]8JM3@]؉EEԉEċA]]ȉ]Љ]]@jZEf9Pu @ PjnE jHEEEPEPQ uM PP趽؅J3ɋSf9HM uЋ*HtHtHHuN뤅u}uB3EEf9Hu 8uBjYEEf9H}jEȋPEPSIC3ɋuf9HuF8uAjEFPEuPSUȍM^QtUMuAuU؍Mu-Cfx@u FujCjYf9HuXuuEM EEFuEً3Nut5EP\G}tE03,MEI@ PjrEjhMJMBM:M2M*_^[]UeeS] VWhEEPE Mj MPSux ɪt~ u%,E @DM@ Ph_^[]U\S]VW{ uSu uoa3D$HD$Ht$L$8t$ t$$t$Ht$PD$TD$ˉt$'uBE E@@ PhL$82L$HL$蚫] Uj5 BYf9Hu0L$<9UB jGZf9PUAωD$PSRxUD$B j5 Xf9AjGXf9Aut$8L$\XD$PD$PD$`Put$$7L$XP E E@fx@ Pjrgp9t$<^@ PhAjD$D$,PSRt$8t$@D$Dxx E @fxt@ PjrL$(kKf|$At$8L$\kD$PD$PD$`PuVML$XftlD$RtUHt5Ht"HtL$D$(P#-t$L$, :L$D$(P]L$D$(P5t$L$,= t$L$,D$(PL$Өt$8L$\D$PD$\PuL$X輠L$(oUt$8L$\D$PD$PD$`Put$$`L$Xy6t$E PEPL$8SL$HL$軨_^[] Uh3SVuW~ u]EEM̉EĉEȉEEEEHEENe試u?E E@@ PhM赟MiM] Uj5 BYf9Hu0MU BjGYjNf9HY}u @ Ph뉋MURPuE @@ Ph_ EPESPLEU j5B Xf9AjNXf9AjGXf9A谫u|A 9f9Hu)~ u#jEuPSRb uS}u@ PhMURP`E @@ PhAσeeVE EPSRE E @fxt@ Pjr@f} Au̍MuEPEPEPVjM蹝tdE RtKHt/HtHtMEPy'uMb7MEP跤 MEPuMuMuEPM0~ u jZu̍MEPEPVbMMKu̍MEPEPEPVuM؜tuu EPM贜MhM_^[] ULUVW} RMjH^uf9puuD@ PjpuMX73ɋ}؋EG@f;EuBf;EuJj@_f;Nj}utxFы} EVPWEԉMĉM̋MPEyQUj@^f9puIjGXLPdu} EuQfEM3jfEAM蒻M؉EEP RuEԋWPj6MEV}uPMj4 E؋4EPMCPbMuE PuEԋWPj>}M!M̋EAEAEA MEuu|H bLuPE ~LMfE3jfE@E M؉EEP VuEԋWPj5MEUMűt?Mj4 McMű ]E PuEWPj=EMEylU3ɋjZf9Pt1E؋@f;EuA f;EuI~ jZf;uB3WhHʥWhH=3M?M荶_^] UV~ tuNF +WjMYtug3FG~_^]y At@V~u hHHthKPHFF^uCU$} uhH6EP]EPu hP虻ufPMfE]U$EPt@@3]U$}u h@0QEP@YYt3EVW}uj Y_^]VjYV^US]3VW} E7j5@PXf;uFut܈ fGuA+jHXf;uu]j5C[Df9X]u2Ift)F7]j5C[f9X]tjHXf;tF_^[] U( WSVWM輴M贴]3ˋvC2ۋ8fj%YFf;f9 wuQM2FhHMǹj%[ftPM Fwf;u3f9wtrfFhPuHMtPQ0hKAEPM踸hKM( PM薶wft 8hKMEPMwt MEPuM5M-_^[]UPSVMMWsMkMc]3ˋ%CE83؉EEEfj$Yj@FZf;f9 wuQM̵FvhHMaj$[ftPM覵Fwf;u3f9wNEFPM覼M覺uu|HSEPEPw؅tgCM0θhKM踸EPM/hKf;f9wuR0hHM衷j@[ftPMFwf;u3f9wEFPMMuu|HMEPEP"xMuM蒶_^]UU EABABA B A]VW3 K9~vF4CFY$G;~rvfCY_^VK0vCY^UVEtVvCY^]UVEtVWCY^]US38EV3WMD$(|$ I+ȉ\$8qND$`AD$dAD$hA L$(D$lE@ȋL$|+‹T$;t'u UF SjH誙CD$pT$|PD$dD$D KP\$L\$P\$T u'u F SjHUjX+D$(D$4\$x\$9\$|}D$D$ FPL$Dt$/GL$4Nt$ t$ D$PAD$TAD$XA D$\kD$0PD$TPvD$0$ЉT$,:9OD$L$Ly 5袺L$0HD$D$$@ L$D$xD$$+;~Fk$$؋D$$k+ΉL$u ΋;fF >};;;u ]EF Qu ΋;F 뙋;u ΋[^]F >M j XfEEEP{t sUY_^[]IGGGGGGhGGGGGGGGG2GUSVu3W} Ή_菦v6HjjjjjhԓKE ;Fs~MnFM +HPAPVM;ju $~KM2t G1ؓKM2uKM2u M褀2[_M蕀GEFEFEF EGPEPCu0~K72t_MG_^[]U,E SVW@}pQV3ۋu ]EBEBEB EFȉEx uMA0(HE:~/F;E @D0uSjHE @Hy u.MEPEPouVH}MԉGxPVH}9ufE @@x u3jAM6M€EPEPuVHMԉ~9u 8]tVHUSjHލM~_^[]U 3S]ȉECCC,9C VW}}E0kuMT8t Fk$3DD$GE j*@ȉEuXF0QY;s@P |uE YH4%N h}VWhV2 Ek<E|D}E j*@ȉEfuļF0PY;sEP{uE YH4苼N1WRYYsE @ pE @ yE @ MNkfhE @ 3NkOE @ vFk]E0E @ WFkE @ תNkMA}M;K _^M[]E @ NNkT뼋E @ɵtz u3ҍFkB둍Fk$9DF _u 觸&F 3^]U\SVW3L$h@t$(l-؉\$YthHsss މ\$EKL$\$@p谷ND$8AD$ B@@G BX Bb BH39A t9yt3fAfF)u <3PjF H菁Ëu GF L$(BuL$89u_^3[]UEVW@RNx,;}$8t0H u 蛴&F _3^]UESVً@0F0(Huuu URW3t8tG;r;uEP) 0u G_F 3^[]USVu3W~v-FHBuu ó!Sj_FH"؋Ne1Nu ԋABABA ΉB SEPّu"e&juF H_^3[]USVW}ًOx t'u 3@jF P&HpL$ r7qj)uu'XNt$ yu ɲjF j몋GL$d$pH|$t!L$L$p茲D$t$Gx u3jQt$D$u P{YPH~L$D_^3[]US]VWMSx t*u U33@WF >PHg~{r3M}}}u}tMCMp輱EuCx uύEPEPEPJzu ؋脱uUF >WuH} F MQ"x u83u ΋6F >_^3[]UEVu W@΋x t&3@jF PHX}8 ߰F >_3^]US]VWKx t'u 訰3@jF P&H|L$ {r7q j)u'Nt$ yu VjF j몋CL$d$pհ|$t!L$衲L$pD$t$CPx u3t$ D$ju RPyjPHC|L$ͯ_^3[]UE@x ux tVu 螯&F ^3]UESVW@3ۈ\$0ND$PT$RYu'u JF SjH{+8\$t$SjH] @HujhKL$KQL$tt$jjH1jjH!jjH{詮#C L$街0jPHjjHzn#C t^jVHu5P@HPHjjHz(#C V\Hu F _^3[]UQESVW@3ۈ]0QNEPU`Qu Y΄u輭3@SF PHz.蟭8]tEF EyHK F _^3[]U^|$0\$4袠jXPjPt$F >^|$8\$^|$@\$DI轫jXjjPt$F >^|$H\$L萫jXjjPt$F >^|$P\$Tc^}j(L$QPHuVjHwbM AjjS跢|$0VjjS蘟 fjXjjPF >|$,SqfjX>F t$\HVjH+w_^3[]USV3D$(KWVjt$8t$u%D$Pt$|L$dBPL$0m L$`jL$<jL$iD$pPWH=W\HM 覣|$4j^VOQVSjjVVS$k3>@F D$0t$D$PjVjjS躝謪L$D$D$yHKjVjjS\$,腝D$D$F t$FD$t$OuL$,_^3[]UQSVW} ً讨'3@jG PHuE@0NEPU L}YujhHtsE@HŪt/Ht%HtHtHt HuJj @j@XPV$H3@G jjHXtV\H_^3[]UEWpPu&Vu 踧&3@jF PH t^CQEEPH jLJO@ M P֫3_]UQESVWpPu'u 03@3SF PHsE 3P,] UJYuu 3@8] tYuShHHEQPEH SLJ O@/ M PSh̋H _^3[]Uu ujj/]Uu ujj]UVu ujjN@ xu+jdžN@ M Ph3^]UVu ujjN@[ xu+jdžN@3 M P 3^]UEu pPj]UEVu pPjN@ xu+jdžBN@ M P薩3^]USVW}پvGHn@G\֋]u(P@HPH,qu 赤&F _^3[]U`SVMMW53EjOq xF3f90t'Gj)p tuRvMW3rGH:Ej<[SEVP8E܃ EG]E@u0Fu]EEEEPu]HtVYtSYu%U3SGWHou*~ e}tUE؉DQu3G}~ t8u HEEyHK]ӢEuF \HMb_^3[]US]VWC0Xjtu2NC0v,} uCHҤi<<H@_^[]USVWjD^V3ۍD$tSP|$<&73t$|@\$ $ f$E \$\$\$,\$(\$ ]t*CH :{D$,vKCH%CH{vECH CH %D$(E tE {vCHujX9CvCH轣f$tD$ C0蔠F} KD$qoN KD$qTN KD$q9N ~{D$v,KqN ]tV3Y=Hjj׋3jZF QSYVD$(Vd{D$v(Cp谟Ft V_3Yuk=4Hjj׋3jZF QYPVD$,׋t$$|$0} t/KhH 諡KhHI蛡KhHI苡T$(L$HRptZsw$L$Hˀgv$L$H"v$"t$2ۀ} KD$8PD$tPVt$,t$,Qt$Dt$,t$8t$8tYt$32YL$tAHut$2YL$tAHut$2YL$tAHut$Yt$Yt$Y*D$8PD$tPVjt$0Pjjt$"Yt u=FGFxF~_^]USVj[F 9FuM jX;r3ɉF W Q~YtFtPvW"v~_SYt M 3ҋNFF^[]UVWF 9FuN jX;r3ɉF jZ Q-~YtFtPvWv~~jYt#U BGBGB G BG3NF-L$L$D$,3PD$PD$$V PVhHVt$lQ`HtIVPHH3VGWHC[u ̎&|$~ t$H|$ Gp Fh K0$YGYup F0!YEGp ʍF8E@p赍FSWj3S0t$ HT$SPHou pjFhp:Fh|K0!YGYu+H ɎD$ GT$$pjL$$Qj zpFhK0!YYu5GH yW؋r΋z 車VyPSj3S2u "&F t$ 5Hփ|$tt$֍L$P:KL$01KL$@(K_^3[]V~u hKHthKPHF39F^UMSVW$puu|H} j^'9usuMhEMV+PEPiKMqMJtVMh(dLx4t KM<HKM'`KMKMKMuoKMu^ДKMuBKMu1KMuKMu37E*EEE EMmI_^[]U(SVE3ɍEPQQQEP]PQVH= EMQPjPVHMuH3ۍM]]tS]MSPV PV H]uG9Et uH3EEPQQQEPPQVH=EK^[]Ã}t uH2UMSVWlM lMl3H}r[WMhj\^f90uJjMhf90u;jWMlSM,CuuMEVWPgFPWMkM?lSMBuuM EVWPfEM+HPFPEPfMSeMnG_^[]US] VWhHUzvJ )EE3F9rvJI E E hYhtz}tVSuMjWaWjYM EPmM-CjuH9}jjH0OVuEPjjHO_^3[]UVW}QAtBtP;u;NuVQ虅'N_^]UVEtVY^]UVuWN tpN pu >3_F ^]UQSVuWF9pVE opJ؃FxExv HI/;yx+;~+M V_MVQP 3_^[]U$ESV@Wt$ oU؋Bou!M hH WjHMljY9JrJI臃jY3F|~3F;tu'ǙtM hH譂T$ jjH뜃;u;ǍL$ +‹VaVjSL$,_M D$ PL$ @WcY3ɉT$ ~+C[D ;|ǍL$ +‹VaVt$L$$jV^M D$ P葁V{YWL$$[WQSL$,@WL$BaD$PD$$Pu^rgM D$P@L$?L$ ?_^3[]UEV@0ND$AD$ AD$A L$D$~M D$PԀL$?3^]USVW}G0~G^p~v3r%GH臁x~3u Vd PV0_u ~>3_F ^[]U SVWM hH芀UJ{ W3F]zv IUVru VrVr;v Vr9rvBH€U3;zv BH 蠀3EtKtFM[VjjS~rpPMO^F;r݋M EPVM>+ƉE@P3]Y;s4E+މ]]EVjjSr M1F;r]E}u G9=M V1SVYYjjHI_^3[]UeEEESVW@E3ۋ0u|FEE@p_|FuEFHHHthHtSHt?HFH5E&u |!3@jF PHHFH~HExɋFH ~EtFH~؅x~3uEuupuS0]u;^u u|3@&F  |3@F C_^3[]UESVW@0X{Fu ΋8{&3C^ ft"PYtfu{^ _^3[]UESVW@0zFu ΋8r{&3C^ ft"PHtfuD{^ _^3[]UESVW@0zFu ΋8{&3C^ ft"PHtfuz^ _^3[]UESVW@08zFu ΋8z&3C^ ft"PYtfuz^ _^3[]UEVW@0 u Wz>3_F ^]UEVW@0 u 'z>3_F ^]UESVW@0xyFu ΋8y&3C^ ft"PHtfuy^ _^3[]UESVW@0yFu ΉEXy3F >tMWvZf*tG;r^y3@F _^3[]UESVW@0xFu ΋8)y&3C^ ft"PHtfux^ _^3[]UESVW@0OxFu ΋8x&3C^ ft"P@Ytfux^ _^3[]UMSVW#V]C0wFpCHzx ;~C0wWjvMWM EPyMf8_^3[]UEVW@0zwFu ΋xw>3_F ^]UEV@0CwNEAEAEA ME7]uuHM EP yM73^]U4SVWL$0U]C0vFL$ D$pXCpvFD$Cp>΄ttyNxYD$\$H;KwGVjSL$,V|$L$ WVYOC++P1PSL$6L$056_^3[]UpVW}G0CuvL$ vWv(GH(xuVL$$$]L$ L$@c7hܕKL$4ZQD$4PL$H7L$05VL$DZ83D$hHL$0t$t$t$Rt$ jD$PL$H 1tD$0PVL$H >D$0PL$͋t$Nx|$4L$$WWNyL$0!5L$(L$@6L$@5M D$ P1vL$ 4_3^]US]VWC0tFMx#RCHv؅x$;~ߋE@0sS+MWvSM EPuMw4_^3[]UEV@0sND$AD$ AD$A L$D$.M D$PUuL$43^]U$SVuWFH)vN؋1sVB rD$B L$L$ Vt$D$ TuA3t2WL$Tf$uWL$|TL$ PSG;r΍D$ tItE3tWL$HTf$tG;r+D$VWPL$,~RD$ PL$lZt$tHtDVL$SfK$tNuFPjD$PL$,1RD$ PL$Zt$tct_jjL$(V23t3_F ^]UVu kEM &F Q@nP{tkE F 3^]UQEMQMQ@mP1t!Vu @kEuF Y^3]UQEVMQ@MQmPtuM luUYjjHC7M hHl3^]U8ESVW@3M}p΃~ uE3PCJ'j[iNE؋AE܋AEA M؉EEAEAEA Et M؃*tMu*]EPou%u j3>@WF PHl6-EMQ@elP u i3>@F 3M *_^[]UEVW@H0!lPhHlPhu i>3_F ^]UVW}GphFjGQkPu 3_F ^]UMj XyvAkx~j XXL3]US]XLWhH{%XLKtCV0@hvXLCP^vCH'kXLXL_3[]U4EeSV@Wp΃~ uE3PCH'j[gNE܋AEAEA M܉EEAEAEA Et M܃Q(tMD(EPmu$u g&3@jF PH<4+EMQ@8jPYu g3>@F M'_^3[]US]XLWhH{%XLzJtCV0fvXLN^vCHi$XLXL_3[]UE3Axv @iQ&]U=RLVtO=RLuFExv"@0FfhjvXLFFhHXLIXL\$jjH2u f&F 3^]Ud$S] VL$W{t$t$tC0eFD$v KIhvKIhD$v KI rhD$M3ҋ}\$+tIu/Rt$VSjPt$VSRXL ϋe7G #huT$PjH1SY_^3[] U$S]VWC0iCpdvL3ۋCST2L$d$0E@pe|$uL$nSPs|$tL$,u2~L$D^u5L$ eBD$ PVju VsL$ $_F 3^]U$SVWuHuu \3GD$3GWPm<M VjWVTL$D$,3ۉL$,SWPV\$D|$HRL$ V\D$WD$$D$$WPV\$8|$QKL$tGp*WvLP&u WT$ 3&@jF PH#L$0xWL$L$ _^3[]USVuWV]~EjPgs]+] FHY؃s}+} FHjYNj)A ȉE hZtEM EYNj)E qEZtE#YMWSPu hu V&F _^3[]USVuVuu TV&F a~Wr5FHXt&8Fp UWv[$8Fp nUWvt_^3[]UQVuWVELt;~vFH1XtEFp Uuv2uu U&F _3^]UVuuu QU&F j0H3^]UKL$FtGpSj KL$ tGpcSjjLKL$t7Gp@SvKTu SF 4KL$tGpRjvjR?KL$tGpRvTЗKL$Vt1GHWUPD$,PWM D$D$(PTKL$tGpVRD$(Pv,W뺺KL$tGp&RvWUIKL$tGpQvWEKL$tGpQjvPu >R&F D$uT$jjHL$8RL$JL$(A_^3[]UUV񃦘J QKtLRYqjp)yjPHu Q&F 3^]UDS]VD$ H3ɋCAWD$ 3L$jt$H.F_^3[]UVu6k)yjPHu K&F W4Hu bK>F _3^]UVujjWj)yjPHu K&F jjj0Hr3^]UVufjji'yjPH&u J&F 3^]UQSVW}Wj3ۋCSiy$jPH0tu JJ&^ e_D$ vGHLD$ vOI LL$ M~yj0HdOu_^3[]U$SVW=4Hu׋ز2EPHu,u IU3F >WjHEPSHPEP:E)EEM )ETCjjV@M33M@}WPEEPV=?MIEE3@}PPEEPV?MH2ҋd_^3[]UVuQhjg&jyPjH M hHkJ0L$/&T$ M D$PIL$3^]U$SVWug} 8H'3CS_ DgjPL$ Q04HttBjSVz?L$4D$+L$, d$L$\$jSPV=L$GD$,+D$$d$SD$D$SPV\$,=L$GjSH_^3[]UVufjtf&jyPjHu 2G&u W8G>_F 3^]U$SVWuf3ۋCSf.y3WP3WSH7u F^ >D$3WP"WM @jSV >L$D$, L$ |$(\$,WSPV<L$ dFD$SD$$D$$SPV|$8\$_^ 3^[]UVudjc"yjPHM hH6FI0 u8L$!D$P pYM D$PEL$W3^]UVucj c"yjPHCM hHE/L$e!D$PTM D$PEL$3^]UVucjb)yjPHu WC&F  g3^]U,SVWh YPL$wh0KD$DhH%]Cu LJ;C04Bv+D{vCpBv*3ۋSay(SPHu fBF  D$ M N j_}9}VHȅ3IEMhhuPVHE@t?Fu8E@t?FW0gPuVtE@E;EwIu}둋}u;}uuVHEuHutEG};};uu ?&F 1u$juhVH2ҋ E_^[uPڴuҴYY3]VjhKHjhhPH3^VjhhjhKHPH~3^U$SVW}W_\$c^j],yjPH# u >&F j0\H@D$ tjjPNrGj)XAu @\$(+\$ |$rGj)xAu @|$,+|$$Ej)@@ȉD$ AtD$ L$k@D$Ej)HA ȉD$ cAtD$$ L$>@|$D$ EHI!@D$tv~d~j XD$T$ L$$T$L$9T$u 9L$ uWSQRNT$ L$QL$QL$jPt8WSt$t$$kOj2YD$WSt$t$HOu ΋8_^3[]USVW}Wg\3ۋCS['3yWPH" u <^ >O0tu <&^ ,0GH>3jWWWW;ujjVH_^3[]USVW}W[3ۋCSM[%yjPHu <&^ OGHx>@uSK1Auj0THP0H<_^3[]USVuWFH>FH >؋V][jZ)yjPHu W;&F Gj0V\Hrt3PjVH PjVHjujVH_^3[]UVuQEEPHjdžҫN@MM P&?3^]UVuYQEEPH萞jdžzN@M P>3^]UVuQEEPH8jdž"N@蝞M Pv>3^]UVuQEEPHjdžʪN@EM P>3^]SVWjXyjQH+4H3B;|9tB;~3_^[3@UVW}WXuGH;iH_^]UVWjggԭYt#U BFBFB F BF37_^]UVuWOFP FGFGFGF G _^]UV+EtVíY^]VW>tOW裭YV蜭Y_^VNaV胭Y^UQSW} ً~ uuuWPYPEPE Pu t^Vj$賬Yt NU3KtEu NPEK,FEFEFEF E P>^_[]UQQSVWj$MCYt K3ۋ}Ku \]PM;,CcECEC EP_^[]UQS] VW{DE t sDHj(HjZVHV3V$HM}1MVu VjjPPQǹ0uVVVPHu jWj0VHE$u1t-jPPPP3HE$utjjhBVHjSu{DP_^[Y] U$XLS]Wjjh0Hu 9E |.$XL t uj0\HuO}GVs)$XL t#uj0\Hu F;54XL~N; $XLjjh0HC;~} $XL^uMjjh0H)j0\H P$XLj0H_[]UE(ujX}M Vu΋U$uփ}0}2nSW}3f9t^SQuRQuuPShKSuu t8WSHhgPӅu-W(Ht"u0Phg6Ӆu6M,A3#M,WQuu$u uuSWhhKQuޥu u2EWW=HhPthdjh6jj h63@=WLuf_^[](UVut2E(@S#E( @P>M,ЋE Aٻ#M,uÉE W}$ujQuWPuuRhHhțKQV ] u2Pj Wu uujPHƆ=WLu f_[^](UVuu2ES3f9tPEEEEPE h>QHM Ɔf<8^8t PVWLx=8^8t jS6XH2[^]UE(SV2Wuj7X P<Ⱥ3@t3ʊ؋E,u @#E,uU$ujQuRVuuuQhHhKPVx} u239tjQQQQQPHt!j7Ƈ\H Pj7H~8t1^E(PE,WLPuҩu(u,t Su,ި3@=WLuf_^[](UxEWLSVWPEPusu2MXL3ɋ9t⋃Ey9| E'MMxE苃xEEủE܍}Ej EY󥋃EtEM$XLuH4Mu E@E} E5HPjh2QjjGEhPG4fG_^[]UEujX uSVWP>:u3SQuSSSSPShKSVeudY7MQMQPWLt_MXL;uLU$XLu6M 5HS9$XLPhiWA4hSheWְ Wt~uh]Hj6HF^]U8EWLPEPu u2M$XL HtZxڃ ~Q t3uˍEE0PjuEq HtM E܉%I t~~w IE ]UQQEWLPEPu\u&M$XLu ]UEWLSVWPEPuu E M3$XL]  M1u g +tlHt9WWhfWWhVH؃W=HShV3@jZ QYVShu ׋WWhGVH؃W=HShIV3@jZ Q軎YVShH3WW=Hh V׀}lDžlQPh<V׋E  =+3Wj h V;HR}EEtFh Y؍EPWh>VE]EHt SVYEPWh>VHEq Hh融}uv4ruEPWh>v4H~MغUt Ht  t D 9z ~SE3PWhVHt,j辋MQMQMQhKVdH;3}WWtGjVH3jZp QfYVPu ElHu u;dEehVHMBWWjVH3jZx QYWVu lHy|uTYpZC3jZ@@ Q辊Yˋ5Kq(SNQϋ/Yp  jq4\Hj4E 3EWP荪E uxpDžpPjhSv4HEIE tE}t?EEPWhKv4EHE Hh ҉EYE3ɉUf;SHuY+ȉMSΧY CfWLf3QfA`HЉEE@;EEEPWhKv4U|HLjjh V5Hj43EWPA EEEPWhKu #E3WWhVH3_^[] UEWLPEPuu3qM$XLV3E+tCHt8HuOEPuu QHUME UM U M M$u(uuuu QH^]$UQQEWLPEPuku3=$XLVut3!u $$XLE3@^] UQQVEWLPEPut1M$XLuE pPju$-3M ^]U EWLSVWPEPu蟝u3MXLME$XLM 87u] 莫H|wHË] tx~tHt-uE zjPGH؛jjw4XH'} Su jh} =u jh VHE E  jPGHi 5Hj7j77HtNAt3t~#jV\H PjVHjS_H@] u;u jPGHʚ)SjhV5HSjh&ujWu*=RLt } u3@_^[]U EWLSVWPEPu蓛u3 MXLME$XLM 87舩ÃtmxtOt>uE jjw4GLXH=RLtt tu{yu jhu jh  u jh$VH믃tt+t)~jV\H PjVHE jWuGLJ)d3@_^[]UQQEWLPEPu\u3!$XLMfE Qf3@]U!^SVWE3PEuPuWLuuuu3MXLM$XLU;t6<tv<vHMtDf91t?EEEEECEXENEKMAEH$HE uNPjuWHtVPuWHEjSP'#E E f; WLtfuP`HHVVuE *HhWLE PP7!tPVuW׋EPjuWӃVPuWVu ͱY(PhWHtu 譱Y'Pjhu 蕱Y'CLFtf91t u jhu WHh?Bh@BhWHEM UjjYYEPVhWH] uj EVP藡 ] hWLE PP t6fEEtEPVh`WHqFSXYtSMYfDCf;WLCE EEPVh`G} [4j4EVPE @8Dž8PjhSSHE} hWLE PP)t;fEEutEPuhtSHFWwYtWlYfDGf;WLbE EEPuuhtSaCE PVh?s4Dž0E 3(GPPh=HEWV0XHhdYDžP0PDžTPVuts DžxHtAXu5E tPPVus HtE0lHW]Y3WTY.9u u WHEjSP#3@_^[] HHHHpHHHHHH2H׌HHގH      UMVWulEWLPEPuxMXLM0$XLEuuEXKDzF| IJ#S] Eu}u E}u FlPM83EGWuuSuPuV[3M_^]USVWM E蹰WLEPEPu蕓3gMXLME$XLM3uU E3@\ IPEPWuu HE๰WLPE ̔ $XLE q@u?3@PPj!jjH $XLEVW} hW q@H!} uPVHEEPQh=WuHfEPyu S<&WSu EPVHE+EЉEE+EԉEEPEPu S,(3FVSu PEPWuu H} u4XLEj[U s4WLV{]] $XLE A@u<@PPj!jjH $XLUPWh  VE A@HEujPH} ȉMEEtEt~v$XLtgUA;Bu\uS9q4uNAEEPWh>VE2HEMUEtEtЍEUPWh?VMHC;] ~EPV4HWWEPVhHu91tEPMEIxupHE8XLP3@3^]UEwf$Hh]hVhOhHhAh:h3h,h%hhhh jhj,HPPH]IH#H{H*H1H8H{H?H{HFHMHTH[HbHiHpHwHU4=RLSVWtu uuFȋ^L$ȃD$(HL$$tjPS H} } LujPwLS HHD$ uj0HjD$(HwHHHD$ GHPS@Ht$ D$0SH|$|$0D$(FD$t6jjD$8P,Hj(HPHHD$0VPS8HVH&|$tjjD$8P,HjjD$8PS;E9XXL;E|/;E*;5PXL"WPHtWHt =LXL5PXL3_@^]U S]VW E E PXL}0HXL3EXLUj_9=4XL$XLtxA;Bup ug"RYt u FGFxF~_^]UVW}QAtBtP;u;NuVQv'N_^]UVW}QAtBtP;u;NuVQ 'N_^]U]UuWLeiȃu]%H} $XLtuuu upHMPPuu]UuWLi $XLft P3@EȋE Qu j uR]UEtMVujjjjVUjuu VHuuVH=lXLtVHlXLVH^]Ue3ɃeVu MSW39~ F^E M>MMU}v}UQuRu>$<umuE uuuuuuE 0suE uKMRQU0E 3uuE 03uB EEEEE GE ;~ v_[ju U^]UEtySVj3SjSu.Tu S]SFPuHSF5HPujCPu uHCPu uր=lXL^[tuHlXLuH]UVuWLfXLj0cEȋE^ ȃ}QuthhuH]U4WuWLmf XLD$j0c}tEȋE  Quh=`XL} jHHHuD$WP#ЉT$b;`XLVL$XLD$$XL&D$D$ jP5`XLkjD$Pt$[ $XLЋD$T$ tu"Rt$Hjjht$HT$ R_Md$d$$YL$D$$D$L$(hDKD$(D$ڼjD$pbLPD$0PL$(ޗhHL$dh\KL$,蟼jD$pbLPD$0P[L$(裗jjt$WLjL$B%`XLE QuhuH_]ULSVWuWLMd XLD$ E \$u'=WLjh`huHuXhHPD$$HD$ PW賺EwY;Q39u@9u7VPh땋}3M|$u u؉\$5uu؋\$|$QWL9c؉\$\$ D$ WLPD$$PS8au$D$VQd}$XLL$ WhJY $XLD$D$ j,V A D$D$4PD$40jD$( D$LD$(D$,D$PPVSt$HD$0t$ HD$~Vt$H;tF;t$|;ND$ x,|$ D$(PjVWHt D$0tNy|$D$ T$NpL$$T$L;t$}:|$ \$D$(PjVWHt D$0tF;|ދ|$\$D$ L$$hPFPQt$Ht$IYWSu E u QhuH_^[]UQQSVW}WLWba XL9} u239EPHVWuuVHu `EtR $XL t<t7t2t-39p t&EPH$XLMV3uuVp 둋EȋE Qu j{WH_^[]USVWuWL`XLu >uCv,`tA $XL 1VFtjWh3HVvj+uH_^[]U\SVWuWL_u D$D$HPVHt$LD$t$LPT$؋ XL D$8$XLL$PQL$DD$Qh3P|$$HWWjVHD$DHD$=dajPD$(\HGf <3Vj h t$,H D$XD$TPVh>t$,D$dHVt$|4XLjY;5$XLt ;GtA;~;jOpTGP!t 3f3@5Hjfmj f`jjh 7HjHfyNFVwV.3Vj h 7HD$XD$TPVh>7D$dHG4;G\  =r=gwD$PD$$WLPVPVt$XLL$jfGfwt$XLL$x(85WLWL$P8$XLL$hHHXLwh07H3PPP5\XLHjj3V5\XLHuHE L$(`XLt$(t$0D$40E L$@FD$(h,Kt$87VD$,pbLPD$HPL$@7D$d D$pHD$0FV5Hj h 7t$4j h 7jVWLD$RD$PHD$P7pH72UȉL$L$u(7HPUȉL$L$SD$$XLL$$<<*D$3D$@D$D$DD$@PVh7H~}|$uv$D$|PVhK7DŽ$HD$HtBD$WLPD$$P$~RtL$$XLL$t9p uD$$D$D$P7HL$$XLH ]D$7D$dHD$0Ft>D$WLPD$$P$QtL$$XLL$9p uD$$D$D$P7HL$$XLH D$+;~E+M+E }+ȋE ++u+uuuU e t@t2f} t++EE++MMjPuQV3HuhjhB3H><u: u1js4hi3H~B߃w1fAf#ºf;uA;Et"pTJ A1f3_^[]ËUQQSVu3ۉUMsAW3;Et+VHGRA9 t4UMPu uK؍4r_^[]UQQS]3VWUEw,9G0~XPFPua: u f9D^txG44FE@;G0E|G0+EO4PNVPx fE fPuFP3 3fD^G0_^[]UQQSVu3W} UMt]HPSu u`HB@N9tFEu %UHMP@Pu uu؋r_^[]UVrW` KE`UJ]$HQ/J< t <t<t33A3;M 1 Q/J3ҋE;nK3;U Q/J39EP/JQ/J3BnK;tǃt3뾺;w=ts r" vi tdt\tTtLQ/J3ɃjXz~o+J;s|s7E=wC<]]] wC< 9M%~![|J;sfff;+u_^[]UQE MSVWxS;E}NE t+4uPlTJYuj+M 6PE HQW'M 3fwƉ9jX_^[]+Vfuf9t2f;tf;^؍E3^UEVWt+4H:Rf;u u3_^]؍EUSVWj_+}t?ff#ùf;u+#=uF## ȁ;u t= t3MM 3B& t%v3B vt ;wыE 3;uvf~ tzE 8B_^[]U S3VBW#EsFu}jXThtǃTt 3HEjY"t  f+E}EUE3@jf;XuD ؃}t,%=u% jX;rf; ؃}t^%j=u## XX؋%=u#% jX;1;$E` K3f;M E`UJ `$HQ/J< <<(Q/JK+ nKA;Q/J3f9CP/JQ/J3AnK;t Y;w=d r~ V MA5F rD ' v0) / _ 0Q/J3Ƀ P f z ĵ ص   , : P : n ¶ ζ ( 8 H X j ̷ ܷ   . < R d v ʸ  > ` z Ĺ Թ  ( : P ` l ̺ ں   , 8 L d z Ȼ ػ &   в x ` t f R   2 D N Z f v   $ 4 F R b | b  0 &'%) M x j R < (  h ~   . @ N \ h |   $ 4 @ L ` l x   " 0 : R ` v  | h X J ^ $  , r ^ J < .  ޿ п t j Z L 8 ,   Ծ t ^ J 8  ڽ ʽ | b H 2  J 8  t d P 4 > μ ¼ | j V J < (    (  ܱ D r X N N d t ܰ   & : Ȱ Ʈ t  s o 49   ( @ V n  0 l V > @@'@D@f@U@@@x@8@@@,BqkB+BKBB KCyBlCkBstaticR`HaFControl Panel\MouseSwapMouseButtons|EAutoIt v3TaskbarCreatedScript PausedExit/AutoIt3ExecuteScript/AutoIt3ExecuteLine/AutoIt3OutputDebug/ErrorStdOutCMDLINECMDLINERAW>>>AUTOIT NO CMDEXECUTE<<<\AutoIt v3 GUIedit SCRIPTGetNativeSystemInfokernel32.dllrb#comments-end#ce#comments-start#cs/v@e.GEEWM_GETCONTROLNAME[:>:]][:<:]]Q\EFILECLOSEFILECOPYFILECREATENTFSLINKFILECREATESHORTCUTFILEDELETEFILEEXISTSFILEFINDFIRSTFILEFILEFINDNEXTFILEFILEFLUSHFILEGETATTRIBFILEGETENCODINGFILEGETLONGNAMEFILEGETPOSFILEGETSHORTCUTFILEGETSHORTNAMEFILEGETSIZEFILEGETTIMEFILEGETVERSIONFILEINSTALLFILEMOVEFILEOPENFILEOPENDIALOGFILEREADFILEREADLINEFILEREADTOARRAYFILERECYCLEFILERECYCLEEMPTYFILESAVEDIALOGFILESELECTFOLDERFILESETATTRIBFILESETENDFILESETPOSFILESETTIMEFILEWRITEFILEWRITELINEFLOORFTPSETPROXYFUNCNAMEGUICREATEGUICTRLCREATEAVIGUICTRLCREATEBUTTONGUICTRLCREATECHECKBOXGUICTRLCREATECOMBOGUICTRLCREATECONTEXTMENUGUICTRLCREATEDATEGUICTRLCREATEDUMMYGUICTRLCREATEEDITGUICTRLCREATEGRAPHICGUICTRLCREATEGROUPGUICTRLCREATEICONGUICTRLCREATEINPUTGUICTRLCREATELABELGUICTRLCREATELISTGUICTRLCREATELISTVIEWGUICTRLCREATELISTVIEWITEMGUICTRLCREATEMENUGUICTRLCREATEMENUITEMGUICTRLCREATEMONTHCALGUICTRLCREATEOBJGUICTRLCREATEPICGUICTRLCREATEPROGRESSGUICTRLCREATERADIOGUICTRLCREATESLIDERGUICTRLCREATETABGUICTRLCREATETABITEMGUICTRLCREATETREEVIEWGUICTRLCREATETREEVIEWITEMGUICTRLCREATEUPDOWNGUICTRLDELETEGUICTRLGETHANDLEGUICTRLGETSTATEGUICTRLREADGUICTRLRECVMSGGUICTRLREGISTERLISTVIEWSORTGUICTRLSENDMSGGUICTRLSENDTODUMMYGUICTRLSETBKCOLORGUICTRLSETCOLORGUICTRLSETCURSORGUICTRLSETDATAGUICTRLSETDEFBKCOLORGUICTRLSETDEFCOLORGUICTRLSETFONTGUICTRLSETGRAPHICGUICTRLSETIMAGEGUICTRLSETLIMITGUICTRLSETONEVENTGUICTRLSETPOSGUICTRLSETRESIZINGGUICTRLSETSTATEGUICTRLSETSTYLEGUICTRLSETTIPGUIDELETEGUIGETCURSORINFOGUIGETMSGGUIGETSTYLEGUIREGISTERMSGGUISETACCELERATORSGUISETBKCOLORGUISETCOORDGUISETCURSORGUISETFONTGUISETHELPGUISETICONGUISETONEVENTGUISETSTATEGUISETSTYLEGUISTARTGROUPGUISWITCHHEXHOTKEYSETHTTPSETPROXYHTTPSETUSERAGENTHWNDINETCLOSEINETGETINETGETINFOINETGETSIZEINETREADINIDELETEINIREADINIREADSECTIONINIREADSECTIONNAMESINIRENAMESECTIONINIWRITEINIWRITESECTIONINPUTBOXINTISADMINISARRAYISBINARYISBOOLISDECLAREDISDLLSTRUCTISFLOATISFUNCISHWNDISINTISKEYWORDISMAPISNUMBERISOBJISPTRISSTRINGLOGMAPAPPENDMAPEXISTSMAPKEYSMAPREMOVEMEMGETSTATSMODMOUSECLICKMOUSECLICKDRAGMOUSEDOWNMOUSEGETCURSORMOUSEGETPOSMOUSEMOVEMOUSEUPMOUSEWHEELMSGBOXNUMBEROBJCREATEOBJCREATEINTERFACEOBJEVENTOBJGETOBJNAMEONAUTOITEXITREGISTERONAUTOITEXITUNREGISTEROPTPINGPIXELCHECKSUMPIXELGETCOLORPIXELSEARCHPROCESSCLOSEPROCESSEXISTSPROCESSGETSTATSPROCESSLISTPROCESSSETPRIORITYPROCESSWAITPROCESSWAITCLOSEPROGRESSOFFPROGRESSONPROGRESSSETPTRRANDOMREGDELETEREGENUMKEYREGENUMVALREGREADREGWRITEROUNDRUNRUNASRUNASWAITRUNWAITSENDSENDKEEPACTIVESETERRORSETEXTENDEDSHELLEXECUTESHELLEXECUTEWAITSHUTDOWNSINSLEEPSOUNDPLAYSOUNDSETWAVEVOLUMESPLASHIMAGEONSPLASHOFFSPLASHTEXTONSQRTSRANDOMSTATUSBARGETTEXTSTDERRREADSTDINWRITESTDIOCLOSESTDOUTREADSTRINGSTRINGADDCRSTRINGCOMPARESTRINGFORMATSTRINGFROMASCIIARRAYSTRINGINSTRSTRINGISALNUMSTRINGISALPHASTRINGISASCIISTRINGISDIGITSTRINGISFLOATSTRINGISINTSTRINGISLOWERSTRINGISSPACESTRINGISUPPERSTRINGISXDIGITSTRINGLEFTSTRINGLENSTRINGLOWERSTRINGMIDSTRINGREGEXPSTRINGREGEXPREPLACESTRINGREPLACESTRINGREVERSESTRINGRIGHTSTRINGSPLITSTRINGSTRIPCRSTRINGSTRIPWSSTRINGTOASCIIARRAYSTRINGTOBINARYSTRINGTRIMLEFTSTRINGTRIMRIGHTSTRINGUPPERTANTCPACCEPTTCPCLOSESOCKETTCPCONNECTTCPLISTENTCPNAMETOIPTCPRECVTCPSENDTCPSHUTDOWNTCPSTARTUPTIMERDIFFTIMERINITTOOLTIPTRAYCREATEITEMTRAYCREATEMENUTRAYGETMSGTRAYITEMDELETETRAYITEMGETHANDLETRAYITEMGETSTATETRAYITEMGETTEXTTRAYITEMSETONEVENTTRAYITEMSETSTATETRAYITEMSETTEXTTRAYSETCLICKTRAYSETICONTRAYSETONEVENTTRAYSETPAUSEICONTRAYSETSTATETRAYSETTOOLTIPTRAYTIPUBOUNDUDPBINDUDPCLOSESOCKETUDPOPENUDPRECVUDPSENDUDPSHUTDOWNUDPSTARTUPVARGETTYPEWINACTIVATEWINACTIVEWINCLOSEWINEXISTSWINFLASHWINGETCARETPOSWINGETCLASSLISTWINGETCLIENTSIZEWINGETHANDLEWINGETPOSWINGETPROCESSWINGETSTATEWINGETTEXTWINGETTITLEWINKILLWINLISTWINMENUSELECTITEMWINMINIMIZEALLWINMINIMIZEALLUNDOWINMOVEWINSETONTOPWINSETSTATEWINSETTITLEWINSETTRANSWINWAITWINWAITACTIVEWINWAITCLOSEWINWAITNOTACTIVEpHE;CմCeG;CմCAutoIt#FSoftware\AutoIt v3\AutoItBF%sd0b7C?CGCCALLDLLCALLBACKREGISTERDRIVEGETFILESYSTEMAUTOITWINSETTITLEAUTOITWINGETTITLECONSOLEWRITEERRORDLLCALLBACKGETPTRDLLSTRUCTGETDATADLLSTRUCTSETDATACONTROLGETHANDLEDLLSTRUCTGETSIZECONTROLTREEVIEWAUTOITSETOPTIONDLLSTRUCTGETPTRADLIBUNREGISTERDRIVESPACETOTALDLLSTRUCTCREATECONTROLGETFOCUSDLLCALLBACKFREECONTROLLISTVIEWDRIVESPACEFREECONTROLCOMMANDDUMMYSPEEDTESTCONTROLGETTEXTCONTROLSETTEXTDRIVEGETSERIALBINARYTOSTRINGCONTROLDISABLEDLLCALLADDRESSDRIVEGETDRIVECONTROLGETPOSADLIBREGISTERDRIVESETLABELFILECHANGEDIRDRIVEGETLABELCONTROLENABLECONTROLFOCUSCONTROLCLICKDRIVEGETTYPECONSOLEWRITECONTROLSENDCONTROLSHOWDRIVEMAPADDDRIVEMAPDELCONSOLEREADDRIVEMAPGETCONTROLMOVECONTROLHIDEDRIVESTATUS@EXITMETHODDIRGETSIZEBLOCKINPUT\Include\DIRCREATEBITROTATEBINARYMIDBINARYLENENVUPDATEDIRREMOVE@EXITCODEclose allDLLCLOSEBITSHIFT#includeCEILINGDIRCOPYDLLOPENEXECUTEDLLCALLCLIPGETDIRMOVECLIPPUTCDTRAYENVGETASSIGNBINARYBITXORd1r0,2BITANDENVSETBITNOTBREAKBITORACOSASINEVALCHRWBEEPASCWATANDECEXPCHRASCCOSd1b#OnAutoItStartRegister#pragma compile#requireadmin#include-once#notrayicond250m0d10m0d5m0GUIDataSeparatorCharMouseClickDownDelayMouseClickDragDelayWinDetectHiddenTextWinTitleMatchModeWinSearchChildrenSendKeyDownDelayExpandVarStringsWinTextMatchModeExpandEnvStringsSendCapsLockModeGUIEventOptionsMustDeclareVarsMouseClickDelayTrayOnEventModeMouseCoordModeCaretCoordModeSendAttachModePixelCoordModeGUIOnEventModeGUICloseOnESCTrayIconDebugGUIResizeModeTrayAutoPauseTrayIconHideWinWaitDelayGUICoordModeTrayMenuModeSendKeyDelaySetExitCodeTCPTimeoutd0r0,1023d1r1,2d100m0d0r0,3%.15gd124cd1#3d0#2d0#1\\[\\nrt]|%%|%[-+ 0#]?([0-9]*|\*)?(\.[0-9]*|\.\*)?[hlL]?[diouxXeEfgGs] oU 8T 8F FFFF/F F FF444#N-+. {20 FFFFFFFF Fż"hN@GpǼ"hN@GpFZ܊M`* pTKBBbad allocationmscoree.dllCorExitProcessRoInitializecombase.dllRoUninitializefmodtgBC_CC$CC_CC]C]CC]CCC_CC??330C??33am/pma/pTKBBUnknown exceptioncsm TK Bd/Ip/I|/I/Ija-JPzh-CNko-KRzh-TWSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPMMM/dd/yydddd, MMMM dd, yyyyHH:mm:ssSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPMMM/dd/yydddd, MMMM dd, yyyyHH:mm:ssen-US  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~kernel32.dllFlsAllocFlsFreeFlsGetValueFlsSetValueInitializeCriticalSectionExCreateEventExWCreateSemaphoreExWSetThreadStackGuaranteeCreateThreadpoolTimerSetThreadpoolTimerWaitForThreadpoolTimerCallbacksCloseThreadpoolTimerCreateThreadpoolWaitSetThreadpoolWaitCloseThreadpoolWaitFlushProcessWriteBuffersFreeLibraryWhenCallbackReturnsGetCurrentProcessorNumberGetLogicalProcessorInformationCreateSymbolicLinkWSetDefaultDllDirectoriesEnumSystemLocalesExCompareStringExGetDateFormatExGetLocaleInfoExGetTimeFormatExGetUserDefaultLocaleNameIsValidLocaleNameLCMapStringExGetCurrentPackageIdGetTickCount64GetFileInformationByHandleExWSetFileInformationByHandleW7Ih7I 7I 8I`8I8I9I`9I9I(:Ix:I:IX;I;I;I ... Microsoft Visual C++ Runtime LibraryBexppowloglog10sinhcoshtanhasinacosatanatan2sqrtsincostanceilfloorfabsmodfldexp_cabs_hypotfmodfrexp_y0_y1_yn_logb_nextafter   (null)(null)EEE50P( 8PX700WP `h````xpxxxx???D???@?@W????w?A? ?@??q????@??}?N?@ ????m?A?????q?H?!?????a?Š#4<Xq?BJ=_D?mKF=Ԛ?s7E=@[-?K>d:=g?Z}=\uI=s~Q?g:"(N='?9~$O1=q?n1%=p)k?vʌ=`X:?q.W =Pi?g>M=[?ֲa M=_3?֍,uXO=`Ɏ/?1w<=>'eH?` JJ=x~? Š&=n`Y?˖C=0?]/=# g?uP= ?,lC=5q?ᕎ =@Dӳ?-[@=pt4z? فpnJ=l?i.Eg<y~??O^'=(Tt? x;;=P?RRF=&?XɣN=J@?~=Ht=c?AzU"=nB?U_lj7=]?qBD= h0"ؿ؍ IQn0ؿHn&E:׿E7D57A׿ %@@ֿ*Z+ASTֿrJD@ӑտNT?w3kտr19]ԿFKm8C!`Կ1y2Y@ Կ*(FEO5iѿ4Q!?: пC +pڌXпxO,C"пAri<q~_ϿR v== ~οo6@mPͿ d+>̿9Ȓ[\˿8B'&˿i[JZOʿbnEDE}ɿUgc@H ȿUZdL" ǿ=Dj!ǿVm:A@`3ƿ~%3kcſ"7M Ŀp>)%ÿ\Bjx¿#6HˆQ;`t-¿=]PH0;TaָE&a-#KV\ Vb4M@U@Xx55@캿D=iI^Gי'7AԷUNҪ1GƴO\C@+Bg:IB@Zu}M:(T!1n]vQ<)8h׾o$|f+x2S74U".mœFB*6IKS_ D 5M-Cz1}BKG c?OfFL,sX4I+xm w$VcE?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@??????????????????????@????@?? ? ?@ ? ? ? ?@ ? ? ? ?@ ? ? ? ?@ ? ? ? ?@ ? ???@????@????@????@????@????@????@????@????@??|)P!?Ua0 !=+34?2Q =`??7; WJ=`7E?'a%C=MkK?*b<=0ɘP?*,z?=d|S?KT'K=R_V?bF=p^BY?E&= 9&\?߇N9=p _?߭Eb2]A=`?f#I=hb?O2H`3=c?e2a1=ԆLe?2RM=f?A3_:=@0h?[2ieO=i?1rK=k?Σ-=l?̈[8=yQm?>|W8A=՛ko?>qݲN=np?z m{ M=t)(q?m,SD=E`q?}e?=ԩr?}~:fE=PSs?&A=& t?,&8=tt?eѴN@=PSu?^p?o40=!9v?W?N=<v?+#GYM=Hw?qC@=Pex?0 &ے=Xy?8=<8y?!({=H= z?d,GB=6K{?ҝE M=¾|?w31!=L|?^X-F=Dfqsg~7(7s6uE(ruv.E,t]rLvOrȚ p&qC"5FzIqoOjpO|Wp Ȯ/N#D5pO/3N^o I!` 1nDCE"Bnu ^!EWΉm--0lNpCP&`l™J$akN8xj[ -=8Riy~ La8i[٬zF+ghk<@8KHg}7ڒ%gmg1&3{4WfI8e}OA8ӌd_\MP4.dó6D@uc2I{bTWB`b.r}X]La6MŞr<P`;ƥIpη_v<-UF^9M\̢N3e[ݻk>? #JY&-DPZXm4I@@7eWO/jUIlNAi0TWq uIbR|m:K@VNQ?|G¾d0`7O84 fXLzB7CIp4"%H`/G: WI`ȃ1D/!H@%OAA9"Ix'8RؔN;*2]@G?E?@D?C?A?@?>?@=?;?@:?8?7?6?4?3?1?@0?.?@-?+?*?)?'?&?$?@#?!?@ ???????@??@???? ? ? ?@ ??@???????@??@?????@??@??@?????@??@???????@??@???????@??@???????@??@???????@??@?????@??@??@?????@??@????????@????@????@???@????@???@????@???????@????@???@????@???????@??~?~?@}?|?|?@{?z?y?y?@x?w?v?@v?u?t?t?@s?r?q?q?@p?o?o?@n?m?l?l?@k?j?j?@i?h?g?g?@f?e?d?d?c?b?b?@a?`?_?_?@^?]?]?@\?[?Z?Z?@Y?X?W?W?V?U?U?@T?S?R?R?@Q?P?P?@O?N?M?M?@L?K?J?@J?I?H?H?@G?>Y"G=>.ܶlWE=>jۋbH=>^IL#=>(i&I=h>gݟP'E=p>*)D=>&N=x>.;ĝ@=H >Qyu3= >c-=@>Rݡ:==> {M= @>C=` >bߔB= >tdC=$ >9O=>B NC=>j&==>.<=@>`lrG=>!ls1= ?8= @? mN=&?UtQ$=X?PiB{^C=?Gv72=@?qlm+=?!.j7/=d?L C=`?m +=P ?5Od% =?r<(?*Hga2=@ ?CI=r ?sA=* ?GTiA= ` ?KՋD=r" ?Dp`q=L$ ?~G=4& ? D='@?E=)?'P<+?f4±cC=@?qWn{;=?gC i8=?XKD=P?G;R"=7?8΁3,'1D=B'@?:+NB=(?1z@J=*?3=+`?wU4?=,?DO=;.?$b=/p?g)([|X>=H1?>gV=20?OBO=*4?bPA<5?e4=f7@?|[{~*L=9?ٹE=t:?G]C='"?@(6F=? #?'A=@H#?43 A=Ax#?uN}*J=C#?)r7Yr7=]D#?.K="=rE$?r =F0$?3=1Z1=H`$?h|=G=gI$?ܩN:=J$?4e 6=K$?{<9==M%?uYPwH=NH%?-*8=Px%?yF.=-Q%?\9 ;,=R%?29Zd@=T&?~YK| =sU0&?WĻ(J=VX&?RIG=X&?W N=Y&?g'9=[&? D"^=2)$7bmLMӿ( ԏS4_ >L|/ dM4g±82qڜ1ןqaPCQo%;9?_0Cw4g%6L&M;k@ڿ81ABۏ1uB)_ Y/󓎣,:x.Ճ^-?ޯԝI-:]=O>O#w_jُBn(+E -V~|_B}_ACK!ܨY:_5Gt/C$>#Hm- MVn@QU^tA$OÄþiM@K8|;2@(AV64oꬠTC9?&u.~Fs:4Կ J_L II=@0(ן$.G?}3Rʏ3 !|.4*ڟ ඄}3? G"jm >; *O 0 :O 2K;޿ Q`4_  ZD 69* F_ T3ʢK M.֢> @_@? 1\hUXpM&Jx3Ҭx/h 78Lv]EV 3Bv9r_cM*5&Lq3?:R$@܎$=K'\?Ъ{b>$EvCIw8R'FG_j,)+jBD|_ `kA%'r BL TE_GO#i# ;^طH?6(`JJ\HB5``.11\?QDTӾ96оk< xE˾CqTR;ǾdG GgL@_h %? SS@b?Wdy>c*GPAiFC.ֿ?53=?͸)a,?][SqnC?nwtӰY?eus<)kp?&<ߑțuE?Ka<>?5a1xH<lX? aJ.?#Eq<1 ?1j<1Lp!?|眊<dD8`<;f?Ud4ݛ u? gVr/eT'?*mb|L%?2L#FG?AֈDh?ԛƟfNJ?:|”<۠*B?&KVU?An/X0y?c~˛@@ccsUTF-8UTF-16LEUNICODE8C8C0<0<+eGW@+eGW@B.?B.?:;=:;=ѱt?ZfUUU?&WU?{?Mu{<`w>,g5RҌ<2ؼcnQU Zsnim?Lyc>=*p%??C;0=|?Ix"<=`` ә?yM==orO?+C==v?R1=PQ ?Ӏb=@P?5M[g?=V?d+[7=?nB>= kz*?w#8=0nط?C#7={?D i00=ˮf?j -=x)?}z= ? 0$=HV?o=X a?;M_8=@? 5=?^@'=L$?/r(==ɥ%?Nl,"=@\r??t8=85R?ӇӜ=L. ? >)g=Ը3U?Ӱ== ?hXg+=og?X=ذ0?{fHn=<w?y5s3R6=)?a8< O4W?4bV0=L?4@=@?Xۓ4=Tk?>_(=?*o=@[c?,=$4b?dO"=lx?#608=ě&m*?ɉh"0=בl?n6ѯ{<9[P?cezb<$?F 8"=8B.?0gǓW.=-DT!?-DT!RUUUUU?vF$I?ɿ3YE?#Yqn?; 9/I?hKd?81UH!G?#$0|f?KRVnTUUUU?~I$I?gɿHB;E?q{雮?x֚? @ @??@>1|MC8C8CX<1 "?';<ï&b?,kg<!J?ĂeT1<1y"?z<F#?Va<$ lc? x<nu?cv5<?0N<ߢ#? "$<bm d?gQ<|a7?麏<ac? 0 H_<А$?]U ?<8Ud?|}}?<5盧?~+< ?)0>B<'HR%?I&<^:ȅe?>!ʎ<sl?ecb~q<ۧ?rʀ<F(&?Zn<'`f?47j<㚦?+i U<oX?F.K;<.'?Yhʼn<4lkQg?;+U<3?М m8<&?<S(?Y=t<:@Xh?,n@4`<$?<n?9ܮ<-)?\<Řwi?=<R%é?f@<*B?aw<G^*?m(<<2;j?PE<?Ҳ?<w*I?n'$<23?z7<[>t?V-Ai<?`DTb< ;?S.<TR*?)R<2k?,%ً<r?SC? <H?Zxgf<`/-?#<މ7m?w <悆a?_"C<lX^?@<{Х/?$8^<]hNp?bX*<?}_Ͼ<s?pt<hf2?$V<4{#s?Ug <?w<J.?IZ <*Ow5?.@<FHv?N <!?j<v(?z"<i68??!<Uۊ<o]2'?I<Рi?G<o? Ιn<9[? |^<.?>oj<._p?1S<X?l<~?o.x<%3d?{=4 L?V!=b#?@g = a?Gz =]ư?6 =oJV?J b='4?/t><w?a`<_?a e=F``?/f =#&?5SmT4<W?Rz< ъ(?vY<k?pY. =y?8'<KuC?j<{ =2<5?ýd =x?"a =@ic?%[9=?kRF<6DC?ş ܬ_<5Z?ȡk*=3?*+xi(<G&?r ly=:3S?z j<[?'<;!?h=<?:<sd?3 =? ?{!mB<<>? *2=2?cMyoG=Vsw?8K$<}?Cl<Ϲ?-<'F?ɕ{<$R?܊)B<#?<c?? ~<F]?&= /?94E<? T9?9* )<l?e/?B6!F=u0wu?M떐 =k`(?<4=?Kp=G"zI?$}Tw5< [?ߪb<Ka?aF7=V j?Ty<R߂e?M]-e<$[?3<Ễ?QZo =n6)}?, ,?؏?M?x%q? ?/xbJ?Ȉb?uÏ?(Z?t?{}2F??_2?>T^?u ??4td? Z?( ?WIY?d?{?|:?S9?s? ?K???l.?Z3?;E?2:@?>?@@?"Ir?64?@Û??765@Z?&+-?w'?Q?Gpt?2&?X9Ш?Bq?/? ?vɛ?Mj$?3?s? b里?V?% S?Vѩ?ߖ%@?U>?2,|?ܜm?Vkށ?9?I@|?P3y??}>v?H|As?#?(b;?탿7?]o-4?Ph0? H,?:5)?Iٓ\%?f,!?갸%?N?$k?oay?*??Y ?$??(?a?9y?9 9R?%R?F?@I?j T?0ұR?VDD?oWsg6?UJ(?>t?2̄λ ?1_?$*2?[ێ?N)?V?l$G~ٮ?+6?tF4؎?,~?"n?<փ]?|ߠL?l6;?6**?|59?:?HK?s7 ?I-?$z?9\?>|.~?-W?^\sY0?:Rp7?mbzA?G4's?IyȊ?%=_?C\2?Ou?m.?M?nw?KK'F?l^?:" ?Ѭ?}6lw?:@?7Z8> ?$ f?e')lW?zD@ [?jq?PJ?FB<'HR%?I&<^:ȅe?>!ʎ<sl?ecb~q<ۧ?rʀ<F(&?Zn<'`f?47j<㚦?+i U<oX?F.K;<.'?Yhʼn<4lkQg?;+U<3?М m8<&?<S(?Y=t<:@Xh?,n@4`<$?<n?9ܮ<-)?\<Řwi?=<R%é?f@<*B?aw<G^*?m(<<2;j?PE<?Ҳ?<w*I?n'$<23?z7<[>t?V-Ai<?`DTb< ;?S.<TR*?)R<2k?,%ً<r?SC? <H?Zxgf<`/-?#<މ7m?w <悆a?_"C<lX^?@<{Х/?$8^<]hNp?bX*<?}_Ͼ<s?pt<hf2?$V<4{#s?Ug <?w<J.?IZ <*Ow5?.@<FHv?N <!?j<v(?z"<i68??!<Uۊ<o]2'?I<Рi?G<o? Ιn<9[? |^<.?>oj<._p?1S<X?l<~?o.x<%3d?{=4 L?V!=b#?@g = a?Gz =]ư?6 =oJV?J b='4?/t><w?a`<_?a e=F``?/f =#&?5SmT4<W?Rz< ъ(?vY<k?pY. =y?8'<KuC?j<{ =2<5?ýd =x?"a =@ic?%[9=?kRF<6DC?ş ܬ_<5Z?ȡk*=3?*+xi(<G&?r ly=:3S?z j<[?'<;!?h=<?:<sd?3 =? ?{!mB<<>? *2=2?cMyoG=Vsw?8K$<}?Cl<Ϲ?-<'F?ɕ{<$R?܊)B<#?<c?? ~<F]?&= /?94E<? T9?9* )<l?e/?B6!F=u0wu?M떐 =k`(?<4=?Kp=G"zI?$}Tw5< [?ߪb<Ka?aF7=V j?Ty<R߂e?M]-e<$[?3<Ễ?QZo =n6)}?, ,?؏?M?x%q? ?/xbJ?Ȉb?uÏ?(Z?t?{}2F??_2?>T^?u ??4td? Z?( ?WIY?d?{?|:?S9?s? ?K???l.?Z3?;E?2:@?>?@@?"Ir?64?@Û??765@Z?&+-?w'?Q?Gpt?2&?X9Ш?Bq?/? ?vɛ?Mj$?3?s? b里?V?% S?Vѩ?ߖ%@?U>?2,|?ܜm?Vkށ?9?I@|?P3y??}>v?H|As?#?(b;?탿7?]o-4?Ph0? H,?:5)?Iٓ\%?f,!?갸%?N?$k?oay?*??Y ?$??(?a?9y?9 9R?%R?F?@I?j T?0ұR?VDD?oWsg6?UJ(?>t?2̄λ ?1_?$*2?[ێ?N)?V?l$G~ٮ?+6?tF4؎?,~?"n?<փ]?|ߠL?l6;?6**?|59?:?HK?s7 ?I-?$z?9\?>|.~?-W?^\sY0?:Rp7?mbzA?G4's?IyȊ?%=_?C\2?Ou?m.?M?nw?KK'F?l^?:" ?Ѭ?}6lw?:@?7Z8> ?$ f?e')lW?zD@ [?jq?PJ?F ? c??-[6?N}X<?]݃?'Z4?e-CS?F?,w?(F_e?X2CQ? ُ㈏?wT?/VW?#(7? L?hC!߶?c(y?-˶?X1Uu??Y.<?PB?>SŎ?6 Ӷ?'P9?z^3? ΂?&1yA?(+_R?mY?}"?ƟlW?P),H?,b??@??c\5j?=Mpm?c+?BpVV?Q9V%?]|=3?.?|_P?%?ػZq\? ,6?5DKBӹ?@IK?Xf?v?'?+3?2y?g/p<?7C ??ED;?h7r?=?(r? EVw?У? ?0SM`??3?/*2?56Yz?Ʊ?Ge?4?%KV?rH?I,+?U&X>?i.?c4?? ?NT?j86?f*"!?~w"?nJR?17!?|GD|??*a?} Ũ<?ƼpAؒ?ZM$^@]>= @Z7@abK?؝Z@t?,@T4s?a g @XpM@D$_@n}in@)M@֐@P(*C? mz@E3&ԿfYeY!@,d&@#7̓B,@@=U&2@UUUUUU@9E47@ @}=m=@@ 8λB@[[@u+E6G@@?@ӸHO3oX ?% #Z."S- >Q!r?M%ᾎ;DŽ cd3>$9t?JyA]VJ]>Q䫢I?ZIο7t`=cH??ZS +ߏ?Y9m|1~-g>b/[E?8QSվ7KǓ>€p?[j3HX& CUx>XzvC?*ɿa#wi#:wB??x#qQ?L yaF5d>2*q?ɾ?c3yƟ0>q澺k?g\>{O>>u>=?)IſX3{9lf??V}X9܈?+*tsJEX*yhU&>3H?ܨ9ԪFr>)(g?VtFcfy>?p6?K=3il??Kk0vB-G? 8dlMV>|s`?Pt"!k?JI>΃+תd?s{c|HY"?X:n>//2?6G^#f??dčDo=z>-Bվy%#(A>ō:?S/|o3fW|aD `N>Fb?kt LR3ec>Df/?@b̰kع??"])E}>r>ľ>nzru>Cԑ?lf6 noP"Q?m˹A>fǰa?+kWZbI#݄,[>=h,?nĠ}P=Ȣ_??+j>&D(>ll?bIJm>gjVa?\yNW> 4w+?UUUUUU??"])>E}>r>>>nz?ru>Cԑ?lf6 n>oP"Q??m˹A>fǰa?+kWZb>I#?݄,[>=h,?nĠ?}PȢ_??dčD?o=z>-B>y%#?(A>ō:?S/|>o3fW|a?D `N>Fb?kt> LR3?ec>Df/?@b̰?k=ع??Kk?0vB-G? 8d>l?MV>|s`?P>t"!k??JI>΃+תd?s{c|H>Y"??X:n>//2?6G?^=#f??V}X9?܈?+*tsJ>EX*?yhU&>3H?ܨ9>ԪFr?>)(g?V>tF?cfy>?p6??K=3=il??x#?qQ?L ya>F?5d>2*q?>?c3y?Ɵ0>q澺k?>g\>{O?>>u>=?)I?X3{9=lf??ZS +?ߏ?Y9?m|1~?-g>b/[E?8QS>7K?Ǔ>€p?[j3H>X& CU?x>XzvC?*?a#wi#:=wB??ӸHO3?oX ?% ?#Z?."S- >Q!r?M%>;DŽ? cd3>$9t?Jy>A]?VJ]>Q䫢I?ZI?7t`cH??fYeY!,d&@#7̓B,=U&2@UUUUUU@9E47 }=m=@@ 8λB[[u+E6G@@@ZM$^]>= @Z7abK؝Z@t?,T4sa g @XpM@D$_n}in)M@֐@P(*C mz<@E3&ԿI,+U&X>?i.c4? ?NTj86f*"!?~w"?nJR17!|GD|??*a} Ũ?ƼpAؒ?߿ED;?h7rۿ=(r? EVw?У׿ 0SM`??3?/*2Կ56Yz⿛Ʊ?Ge?4%KV<?rH?BpVV̿Q9V%?]|=3ſ.߿|_P?%?ػZq\ ,6ڿ5DKBӹ?@IK?Xf䵿vӿ'?+3?2yڿg/p?7C ?>SŎ6 Ӷ?'P9z^3տ ΂?&1yA?(+_RmYп}"?ƟlW?P),H,bſ?@??c\5jӿ=Mpm<?c+?'Z4e-CS?F,wʿ(F_e?X2CQ? ُ㈏wT¿/VW?#(7? LhC!߶c(y?-˶?X1Uuɿ?Y.?PB?_CN?Fn 棿 c??-[6N}X?]݃?m0_$@m0_$@xC8C@DT!?DT!?@gg2LL#F=J47ࢨ:Esp.:3gg2=?`C<<?1mm.s,)?'>?i i1mm.s?,)'><i? i<ȿmb<Z" ?.ҿu<ϕk|?c}ؿ,g<ysh:?;8]+޿ ^ty[g?h9; %S ? %L jh2yʿ;f 4݋<Xw$3Ak ł<࿇暳s)f09N,J?8v<uZEeu?F2k Wt-v1-VA`пgY?\ϗb buпP/Ye?&%ѣ@}<P/Ye&%ѣ@}<?gY\ϗb bu?-v1?-VA`?uZEeuF2k Wt?N,J8v<?暳s?)f09?Xw$3?Ak ł<?2y?;f 4݋<?S Ϳ %L jh?ty[gſh9; %?ysh:;8]+޿ ^?ϕk|c}ؿ,g<?Z" .ҿu<?i i<ȿmb<?1mm.s,)'><?UUUUUUſ?UUUUUU?*llV4V>>m0_$@8C`a=`a=@T!?sp.c;`C?i i1mm.s?,)'><i? i<ȿmb<Z" ?.ҿu<ϕk|?c}ؿ,g<ysh:?;8]+޿ ^ty[g?h9; %S ? %L jh2yʿ;f 4݋<Xw$3Ak ł<࿇暳s)f09N,J?8v<uZEeu?F2k Wt-v1-VA`пgY?\ϗb buпP/Ye?&%ѣ@}<P/Ye&%ѣ@}<?gY\ϗb bu?-v1?-VA`?uZEeuF2k Wt?N,J8v<?暳s?)f09?Xw$3?Ak ł<?2y?;f 4݋<?S Ϳ %L jh?ty[gſh9; %?ysh:;8]+޿ ^?ϕk|c}ؿ,g<?Z" .ҿu<?i i<ȿmb<?1mm.s,)'><?UUUUUUſ?UUUUUU?*llV4V>>m0_$@8C`a=`a=@T!?sp.c;`CI?I@IAICIDIFIGIIIJIK IN(IO0IP8IV@IWHIZPIeXIH`IlIxI/IIIII 2I I I IIIId/I|/IIII I,I8IDIPI\IhItII I!I"I#I$I%I&I'I)I*I+I,I-(I/4I2@I4LI5XI6dI7pI8|I9I:I;I>I?I@IAICIDIEIF IGII$IJ0IKICIkI I I I I I I I; 0Ik JI7JI (JNI/4JtI@JLJZI XJOI(dJjHIpJaI|JPIJJQIJRI-JrI1Jx I:JIHI?JJSI2JyxI%JgpI$JfJI+Jm(J8I=4J(I;@JI0LJXJwdJupJUI|JJTJIJI6J~IJVIJWJJJJI JXIJY0I<$J0J<JvHJITJ[`I"`JdlJ|JJJJJ IJ\DIJJJ J(I8JDJ]I3PJzPI@\JI8lJI9xJ0IJ^Jn8IJ_I5J|PI Jb@IJ`I4JJ{I'JiJoJ$J4J@JLJXJdJFpJparbgcazh-CHScsdadeelenesfifrhehuisitjakonlnoplptroruhrsksqsvthtruridukbesletlvltfavihyazeumkafkafohimskkkyswuzttpagutateknmrsamnglkoksyrdivar-SAbg-BGca-EScs-CZda-DKde-DEel-GRfi-FIfr-FRhe-ILhu-HUis-ISit-ITnl-NLnb-NOpl-PLpt-BRro-ROru-RUhr-HRsk-SKsq-ALsv-SEth-THtr-TRur-PKid-IDuk-UAbe-BYsl-SIet-EElv-LVlt-LTfa-IRvi-VNhy-AMaz-AZ-Latneu-ESmk-MKtn-ZAxh-ZAzu-ZAaf-ZAka-GEfo-FOhi-INmt-MTse-NOms-MYkk-KZky-KGsw-KEuz-UZ-Latntt-RUbn-INpa-INgu-INta-INte-INkn-INml-INmr-INsa-INmn-MNcy-GBgl-ESkok-INsyr-SYdiv-MVquz-BOns-ZAmi-NZar-IQde-CHen-GBes-MXfr-BEit-CHnl-BEnn-NOpt-PTsr-SP-Latnsv-FIaz-AZ-Cyrlse-SEms-BNuz-UZ-Cyrlquz-ECar-EGzh-HKde-ATen-AUes-ESfr-CAsr-SP-Cyrlse-FIquz-PEar-LYzh-SGde-LUen-CAes-GTfr-CHhr-BAsmj-NOar-DZzh-MOde-LIen-NZes-CRfr-LUbs-BA-Latnsmj-SEar-MAen-IEes-PAfr-MCsr-BA-Latnsma-NOar-TNen-ZAes-DOsr-BA-Cyrlsma-SEar-OMen-JMes-VEsms-FIar-YEen-CBes-COsmn-FIar-SYen-BZes-PEar-JOen-TTes-ARar-LBen-ZWes-ECar-KWen-PHes-CLar-AEes-UYar-BHes-PYar-QAes-BOes-SVes-HNes-NIes-PRzh-CHTsraf-zaar-aear-bhar-dzar-egar-iqar-joar-kwar-lbar-lyar-maar-omar-qaar-saar-syar-tnar-yeaz-az-cyrlaz-az-latnbe-bybg-bgbn-inbs-ba-latnca-escs-czcy-gbda-dkde-atde-chde-dede-lide-ludiv-mvel-gren-auen-bzen-caen-cben-gben-ieen-jmen-nzen-phen-tten-usen-zaen-zwes-ares-boes-cles-coes-cres-does-eces-eses-gtes-hnes-mxes-nies-paes-pees-pres-pyes-sves-uyes-veet-eeeu-esfa-irfi-fifo-fofr-befr-cafr-chfr-frfr-lufr-mcgl-esgu-inhe-ilhi-inhr-bahr-hrhu-huhy-amid-idis-isit-chit-itja-jpka-gekk-kzkn-inkok-inko-krky-kglt-ltlv-lvmi-nzmk-mkml-inmn-mnmr-inms-bnms-mymt-mtnb-nonl-benl-nlnn-nons-zapa-inpl-plpt-brpt-ptquz-boquz-ecquz-pero-roru-rusa-inse-fise-nose-sesk-sksl-sisma-nosma-sesmj-nosmj-sesmn-fisms-fisq-alsr-ba-cyrlsr-ba-latnsr-sp-cyrlsr-sp-latnsv-fisv-sesw-kesyr-syta-inte-inth-thtn-zatr-trtt-ruuk-uaur-pkuz-uz-cyrluz-uz-latnvi-vnxh-zazh-chszh-chtzh-cnzh-hkzh-mozh-sgzh-twzu-za ((((( H ((((( H   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~=L>LAUSER32.DLLMessageBoxWGetActiveWindowGetLastActivePopupGetUserObjectInformationWGetProcessWindowStatione+000EEE00P('8PW700PP (`h`hhhxppwppCreateFile2U?wB%K=?[?(6Ng=?$?V`t>?տ?2n{a>?? M=?H{? {4r>?Pא?"">?u[?* >??G0_(>?4wb?i^^?(>?0?p3>?@?FM>?8M?BV>?d?}Ba.>?ȴ ?d>?g?ߊ>?@?f\*>?~e?-f>?]%?D G?>? ?\>>?X?1 #>?E?h>???ⳇ>??$ 49>?x8?k0H<>??rش8>?8fm?"m>">?ħ?[?k?"%>??݉@fR8>??T:>?T!?3&F >??<[#>?%?Y:/(A6>??N2>?8O?r!' >?r?8{K>?p?9l9$>? G?aj i9>?T|?'\|#<>?$?}dj#>?Wn?׈MVx:>?,?18o,>?D$? c/ >?@ |?x7|1>?|?9>?p #?IAu=>? s?xٴ4>?p?edf&.>?,?fA>?h*?v2>?$gN?RE\K>?q?'^IE>?DΒ?&aH>?L?&KrQF>?,?#/'>?إ?]Xc?>??Ԯ}>?e.?IdWA>?K?ΐ?>?Xg?4*A>?_?[džJ>??10H>??hc#]G>@,*?Qx F>@@p?ekR.N>@?Ӿn@>@b?O>@$Q/?CJO>@@E?G>@[?3E{A>@Tp?SfIS:>@X΅?B6)1<>@@3?>ځ7>@$?s(N>@@?V 6f=>@(?{>@@(W?-Jg >@?"aPK>@xm ?,Sڤ6>@?6hb">@@-?k,<>@X>?0=>@O?׀IXH>@-_? @>@@n?2E>@P~?=ő8>@lj?[j&,>@L7?x82>@@?c#VB>@0?7ڨ.Y>@P?[p&>@ؔ?h4MA>@@?EplE>@+?o$E>@h?\*K>@?-?B>@@P8?(l|@>@p!?u@J>@@p-?V1> @89?5>@ @ @h)P?R`DOG> @T[?9%K> @Mf?/<>@ @q?Ò?> @{?42G<> @L?Â|/> @Y?s @>@ @k?Òa@> @XS?x(3u8> @?vO,ib> @ȥ?&L͒C>@ @?}L> @X?Lo> @x?-Ϡ9> @s?6FID?9>@ @8J?gsL> @d?y> @?>&09C>@? @@(J?IV C>@`w?^@N>@?#%@>@s?MK>@@D'?ήQ->@.?9 !G>@6?.1>@>?.1NcB> @cE?sǔ1>@@LL?nHN>`@HS?W$>@8Z? Ȃq;>@a?N/[7>@(h?=mC>@0oo?H75M>@Hv?P.#> @|?G7>@@*?#42I>`@?ooJ>@?-#>@?h% F>@@?Rx^D>@PP?s@>@4L?P_! #> @4?:#G>@@L?qg:&J>`@Hɹ?5L$.4>@\w? !1C>@? [<>@D?<=@? ~=@y?B> @?~.4>@@h?u|8>`@E?A8yL;>@h?41C>@{?-+oF>@$?xO>@s?՝mT2>@W?=> @-?î\=>@@?\==`@ ?j\&">@X? 1D>>@?#O#`I>@?}0>@?F\IE>@t{#?ׯ,B> @0'?E ]$>@@,>,?ކ?5>`@0?iIqE>@4?ha;>@9?AD>@.=?̤KFw=@DMA?=@`E?apI0H> @gI?:->@@cM?%Q>`@@UQ?Ly5ښoE>@;U?vg0/>@Y?jv UG>@\?yK>@,`?A%My>@md?H> @ h?pM>@@0k?k}<>`@ho?f7O>@r?}O>@v?+ iI>@@z?bB'=>>@`}?ZM>@?1M> @a?R~=@@t?QNT B>`@x?W3cL>@ g?+(=@D?qJK>@L?;,*>@8!?D>@,O? E> @Du?in]D>@@?%3F>`@P?^F"VM>@?}30}->@@?~F y;>@?l R(>@躰?\7`>@?dg;> @?;Sv@E>@@<|?M>`@Y?|};2>@,0?@$?̯/p">@?\(0>@|?[s$F>@I?dӔV> @T?0)LK>@@h?)5G5>`@XY?|zJ>@@?W޾L?>@0?6:>@<3?QB>@x?7o/M>@Q?KcZ0> @?z-A5>@@Z?"BDcI>`@?`I.>@ L?Ld%>@ ?"l"w =@(??!>@?j^J>@8?ϞH0> @LL?%C>@@T?J+N>`@d?;l>0>@B?^{v@>@Ȋ?@Y˕B>@@?Tl0>@ ?w4n4>@G?oN=;> @h|?L{/>@@< ?Bnu5>`@ ?`,+>@d? 5>@$?l >@C?~+^M>@^?PKQD>@,u?^{#tF> @|?^4K >@@?4O >>`@?XEړ J>@?(gԹ,>@ ?43-spF>@"?P`E5+*>@$?=Q QD> @-DT!?\3&<$(J0(J8(JD(JP(J\(Jh(Jx(J(J(J(J(J(JpwK(J(J(J(J(J(J(J(J(J(J(J(J(J(J)J)J)J )J)J)J)J)J )J$)J()J,)J0)J4)J8)J<)J@)JD)JH)JL)JP)JT)JX)J\)J`)Jd)Jh)Jl)Jx)J)J)J)J)J)J)J)J*J0*JP*Jp*J*J*J*J*J+J8+JH+JL+JT+Jd+J+J+J+J+J+J+J,J8,J`,J,J,J,J,J-JH-JpwKd-Jx-J-J-J-J__based(__cdecl__pascal__stdcall__thiscall__fastcall__vectorcall__clrcall__eabi__ptr64__restrict__unalignedrestrict( new delete=>><<!==!=[]operator->*++---+&->*/%<<=>>=,()~^|&&||*=+=-=/=%=>>=<<=&=|=^=`vftable'`vbtable'`vcall'`typeof'`local static guard'`string'`vbase destructor'`vector deleting destructor'`default constructor closure'`scalar deleting destructor'`vector constructor iterator'`vector destructor iterator'`vector vbase constructor iterator'`virtual displacement map'`eh vector constructor iterator'`eh vector destructor iterator'`eh vector vbase constructor iterator'`copy constructor closure'`udt returning'`EH`RTTI`local vftable'`local vftable constructor closure' new[] delete[]`omni callsig'`placement delete closure'`placement delete[] closure'`managed vector constructor iterator'`managed vector destructor iterator'`eh vector copy constructor iterator'`eh vector vbase copy constructor iterator'`dynamic initializer for '`dynamic atexit destructor for '`vector copy constructor iterator'`vector vbase copy constructor iterator'`managed vector copy constructor iterator'`local static thread guard' Type Descriptor' Base Class Descriptor at ( Base Class Array' Class Hierarchy Descriptor' Complete Object Locator'CONOUT$1#SNAN1#IND1#INF1#QNAN((I8AOۙ^ERROR : Unable to initialize critical section in CAtlBaseModule n Bn Bn BIncludezFF2CkFjF@GUI_CTRLID@GUI_WINHANDLE@GUI_CTRLHANDLE@TRAY_IDFG          ! ! G !    ! ! G!   !       ! K ! ! K! y! ! ! ! ! ! ! ! ! ! ! O! ! ! ! a! ! ! ! ! ! ! ! ! ! 8! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ~! +*! ]! (*! ?*! =! E! G! *! *! *! .! 2! 3! 6! 5! 1! (! D! /! -! )! )! +! *! )! &! ! '! ! %!     t       & % @ ?   "  ;  &    3    /  7    +  C     " ; &  3  / 7   + C    " &  + /    3 7  & ;   ~ P           0                1 11 1 7 7 ? ? ? ? ? ? Y Y Y Y ^ ^ ^                         + + + + + + + 5 5 5 5 5 5 5 5 6 6 6 6 6 6      $ $ $ $ $ $ $ / / / / / 8 8 88 8 8     9 9 9 9 9 9 9 9 9 & & & & & & &  `           ( ( ( ( - - 2 2     3 3         % % % %% % % " " " " " " 4 ' ' ' ' ' '      Z Z Z Z Z Z Z = = = = = = K K K K \ \ \ \ E E E E E H H H H K     ! ! ! ?! ?! ?! A   J V d  p ~                 C! GA! K! ! ! ! !      0 ! ! ! ! ! ! ! ! ! !       : : : :              < < < U U U L L L L   N N N N ! u! Z! Z0 0 0 0 @ @ J J J J J D D D D I I I I S S S S S C C C C C & [ [ [ [ V V V V V V       #    F B ) )   ; ; * * * (  . , ,  P P P A A A G G a `     W W W M M R R Q Q X  ] ] ] ] ] ] T T T T Td d _ _ _ _ _ c c c c c e e e e > > > O b b b b     SsE`a&!Kk*!+!  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~xHPK?0123456789ABCDEF@@$@?P?Y@@ ..(# pqrstuvwxyz{$--%"!' &,[\`abcdefghijkmno] _  dBKlBKBKBKBKBKBKBKBKBKBKBKBKBKBKCKCKCKCK CK(CK0CK8CKDCKLCK\CKhCKtCKCKCKCKCKCKCKCKCKCKP%IDK DK DK0DK@DKPDK`DKpDKDKDKDKDKDKDKDKEKEK(EK8EKDEKPEK\EKhEKxEK\IEKEKEKEKEKFK8FK\FKxFKFKFKFKFKFKGK(GK@GK\GKtGKGKGKGKGKGKHK0HKDHKTHKdHKpHKHKHKHKHKHK%IHHKHKHKHKHKIKIK$IK0IK?@[\]^_` _A3cA(((((       !!!"#$%&''!()*'+,-./!-01233!!3445!!6789:;<=>?@!ABCDEF!!!!!!!GHIJJKLMNOPQR!SS!T!U!!!!S!!V!WX!YZ![!!!Z!\]!!^!!!!!!!_!!`!!`!!!!`abbc!!!!!d!!!!!!!!!!!!!!!!!!!!!!!!!!!!eeeeeeeeefffffffffffffffffffffeeeeeggffhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhjkjkfljkmmnooommmmmlpqqqmrmsstuvuuwuuxyzu{uuu|}m~uuuuuutjkjkjkjkjktjkjkthhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmfhhhhhhhhhhh hmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm     mm mmmmmmmm mmmmmmmm  mm                mmm mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm                !!""""""""""##########!!!$%$%&&mmmmm!!!!!!!!!!!!!!&!!!!! !!!!!!!!!!!!!m!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!m!m       mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm'''''''''''''''''''''''''''''''''''''''''''(())))*))))))())**))'++++++++++,,,,,,''''''**))'''')))'(((''((((((('''))))''''''''''''')(*))(((((()'(++++++++++((();;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<;;;;;;;;;;;;;;;;;=>>>>>>>>>>>>>>>>>>>>>>>>>>?@mmmAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBmmmmmmmmmmmmmmmCCCCCCCCCCCCCmCCCCDDDmmmmmmmmmmmEEEEEEEEEEEEEEEEEEFFFmmmmmmmmmGGGGGGGGGGGGGGGGGGHHmmmmmmmmmmmmIIIIIIIIIIIIImIIImJJmmmmmmmmmmmmKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLLMLLLLLLLMMMMMMMMLMMLLLLLLLLLLLNNNONNNPKLmmQQQQQQQQQQmmmmmmRRRRRRRRRRmmmmmmSSSTSSSSUUUVmWWWWWWWWWWmmmmmmXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXmmmmmmmmXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXUXmmmmm;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;mmmmmmmmmmZZZZZZZZZZZZZZZZZZZZZZZZZZZZZmmm[[[\\\\[[\\\mmmm\\[\\\\\\[[[mmmm]mmm^^__________``````````````````````````````mm`````mmmmmmmmmmmaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaammmmbbbbbcccbbcbbbbbbaaaaaaabbmmmmmmddddddddddemmmffgggggggggggggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhhhiijjimmkklllllllllllllllllllllllllllllllllllllllllllllllllllllmnmnnnnnnnmnonoonnnnnnnnmmmmmmnnnnnnnnnnmmnppppppppppmmmmmmppppppppppmmmmmmqqqqqqqrqqqqqqmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmsssstuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuustssssststttttsttuuuuuuummmmvvvvvvvvvvwwwwwwwxxxxxxxxxxsssssssssxxxxxxxxxmmmyyz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{zyyyyzzyyzyzz{{||||||||||{{{{{{}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmm!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ttttteeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeennnnneeeennnnn!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeenhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmmmmmmmmmhhhh!!!!!!!!mmmmmmmmttttmmmmmmttmttllllttmttlllttmmttmllltttttlllmmttmttllm emmemeeeeeeeeeeeeemmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm!!!!!!!eemmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm44444444444444444444444mmmmmmmmm4444444m4444444m4444444m4444444m4444444m4444444m4444444m4444444m  f mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm hhhh fffffmmmhh fmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmfffffffff!!e!!!!!!!!f!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmee!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm11111111111111111111111111111mmmmfmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm    mmmmmmmmm mm          mm    '''''''''''''''' ''''''---'(mmmm                                                          mmmmmmmmmmmmmmmmmmmmmmmm  mmmmmmmmmm444444mm444444mm444444mmmmmmmmm4444444m4444444mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm22222222222222222222222mmmm3333333333333333333333333333333333333333333333333mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm!!!!!!!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhmmmmmmhhhhhhhmmmmmmmmm m  mmmmmmmmm   fmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm    !!!!!!!!!!!!!!!!! mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhmm"""""""""""""""""""""""""""""mmm#################################################mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$m%%%%mmmmmmmmmmmm&&&&&&&&&&&&&&&&&'&&&&&&&&'mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm((((((((((((((((((((((((((((((m)************************************mmmm********+,,,,,mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm----------------------------------------........................................////////////////////////////////////////////////000000000000000000000000000000mm1111111111mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm222222mm2m22222222222222222222222222222222222222222222m22mmm2mm23333333333333333333333m455555555mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm6666666666666666666666777777mmm899999999999999999999999999mmmmm:mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<<<<<<<<<<<<<<<<<<<<<<<mmmmmm<<mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm=>>>m>>mmmmm>>>>====m===m===========================mmmm>>>mmmm>????????mmmmmmmm@@@@@@@@@mmmmmmmAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDmmmEEEEEEEFFFFFFFFFFFFFFFFFFFFFFmmGGGGGGGGHHHHHHHHHHHHHHHHHHHmmmmmIIIIIIIIJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKmLMLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMMMMMMMMMMMMMMOOOOOOOmmmmPPPPPPPPPPPPPPPPPPPPQQQQQQQQQQmmmmmmmmmmmmmmmmRRSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSSSRRRRSSRRUUVUUUUmmmmmmmmmmmmmmWWWWWWWWWWWWWWWWWWWWWWWWWmmmmmmmXXXXXXXXXXmmmmmmYYYZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYY[YYYYYYYYm\\\\\\\\\\]]]]mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm^^_````````````````````````````````````````````````___^^^^^^^^^__````aaaammmmmmmbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmcccccccccccccccccccccccccccccccccccccccccccdedeeddddddedmmmmmmmmffffffffffmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmgggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmiiiimmmmmmmmmmmmjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkmmmmmmmmmmmkllllllllllllllllllllllllllllllllllllllllllllllmmmmmmmmmmmmmmmmmmmmnnnnnnnnnnnnnmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmohhhooooohhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ppp!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmqqqqqqqqqqqqqqqqqqqqqqqqqqrmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmm  !"#$%&'()))*+,-./0123456789:;<=>?@ABBCDEFGHIGJKLLBMBBNOPQRSTUVWXYZ[\]^G___________________________________________________`___________________________________________________________________________________________________________________________________________________________________abccccccccdeefghijklmnopqrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstyzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{__|}~OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOGOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO______________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO____OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{!ALTBACKSPACEBSDELDELETEDOWNENDENTERESCESCAPEF1F2F3F4F5F6F7F8F9F10F11F12HOMEINSINSERTLEFTPGDNPGUPRIGHTSPACETABUPPRINTSCREENLWINRWINSCROLLLOCKNUMLOCKPAUSECAPSLOCKNUMPAD0NUMPAD1NUMPAD2NUMPAD3NUMPAD4NUMPAD5NUMPAD6NUMPAD7NUMPAD8NUMPAD9NUMPADMULTNUMPADADDNUMPADSUBNUMPADDOTNUMPADDIVAPPSKEYLCTRLRCTRLLALTRALTLSHIFTRSHIFTNUMPADENTERBROWSER_BACKBROWSER_FORWARDBROWSER_REFRESHBROWSER_STOPBROWSER_SEARCHBROWSER_FAVORTIESBROWSER_HOMEVOLUME_MUTEVOLUME_DOWNVOLUME_UPMEDIA_NEXTMEDIA_PREVMEDIA_STOPMEDIA_PLAY_PAUSELAUNCH_MAILLAUNCH_MEDIALAUNCH_APP1LAUNCH_APP2OEM_102MOUSE_LBUTTONMOUSE_RBUTTONMOUSE_MBUTTONMOUSE_XBUTTON1MOUSE_XBUTTON2CTRLDOWNCTRLUPALTDOWNALTUPSHIFTDOWNSHIFTUPLWINDOWNLWINUPRWINDOWNRWINUPANDORNOTIFTHENELSEELSEIFENDIFWHILEWENDDOUNTILFORNEXTTOSTEPINEXITLOOPCONTINUELOOPSELECTCASEENDSELECTSWITCHENDSWITCHCONTINUECASEDIMREDIMLOCALGLOBALCONSTSTATICFUNCENDFUNCRETURNEXITBYREFWITHENDWITHTRUEFALSEDEFAULTNULLVOLATILEENUMABSERROREXTENDEDMSECSECMINHOURMDAYMONYEARWDAYYDAYPROGRAMFILESDIRCOMMONFILESDIRMYDOCUMENTSDIRAPPDATACOMMONDIRDESKTOPCOMMONDIRDOCUMENTSCOMMONDIRFAVORITESCOMMONDIRPROGRAMSCOMMONDIRSTARTMENUCOMMONDIRSTARTUPCOMMONDIRLOCALAPPDATADIRAPPDATADIRDESKTOPDIRFAVORITESDIRPROGRAMSDIRSTARTMENUDIRSTARTUPDIRCOMPUTERNAMEWINDOWSDIRSYSTEMDIRSW_HIDESW_MINIMIZESW_MAXIMIZESW_RESTORESW_SHOWSW_SHOWDEFAULTSW_ENABLESW_DISABLESW_SHOWMAXIMIZEDSW_SHOWMINIMIZEDSW_SHOWMINNOACTIVESW_SHOWNASW_SHOWNOACTIVATESW_SHOWNORMALSW_LOCKSW_UNLOCKTRAYICONVISIBLETRAYICONFLASHINGSCRIPTFULLPATHSCRIPTNAMESCRIPTDIRSCRIPTLINENUMBERWORKINGDIROSTYPEOSVERSIONOSBUILDOSSERVICEPACKOSLANGPROCESSORARCHOSARCHCPUARCHKBLAYOUTAUTOITVERSIONAUTOITEXEIPADDRESS1IPADDRESS2IPADDRESS3IPADDRESS4CRLFCRLFDESKTOPWIDTHDESKTOPHEIGHTDESKTOPDEPTHDESKTOPREFRESHCOMPILEDCOMSPECUSERNAMETEMPDIRUSERPROFILEDIRHOMEDRIVEHOMEPATHHOMESHARELOGONSERVERLOGONDOMAINLOGONDNSDOMAININETGETBYTESREADINETGETACTIVENUMPARAMSHOTKEYPRESSEDAUTOITPIDAUTOITUNICODEAUTOITX64UNICODEMUILANG???UGP-L@XTKhTKjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-\P{Lu}\h\P{Nd}\P{L}alphalowerupperalnumasciiblankcntrldigitgraphprintpunctspacewordxdigitMARKACCEPTCOMMITFFAILPRUNESKIPTHEN    \P{Xan}\b(?=\w)\p{Xps}\P{Xps}\P{Xwd}\p{Nd}no error\ at end of pattern\c at end of patternunrecognized character follows \numbers out of order in {} quantifiernumber too big in {} quantifiermissing terminating ] for character classinvalid escape sequence in character classrange out of order in character classnothing to repeatoperand of unlimited repeat could match the empty stringinternal error: unexpected repeatunrecognized character after (? or (?-POSIX named classes are supported only within a classmissing )reference to non-existent subpatternerroffset passed as NULLunknown option bit(s) setmissing ) after commentparentheses nested too deeplyregular expression is too largefailed to get memoryunmatched parenthesesinternal error: code overflowunrecognized character after (?<lookbehind assertion is not fixed lengthmalformed number or name after (?(conditional group contains more than two branchesassertion expected after (?((?R or (?[+-]digits must be followed by )unknown POSIX class namePOSIX collating elements are not supportedthis version of PCRE is compiled without UTF supportspare errorcharacter value in \x{} or \o{} is too largeinvalid condition (?(0)\C not allowed in lookbehind assertionPCRE does not support \L, \l, \N{name}, \U, or \unumber after (?C is > 255closing ) for (?C expectedrecursive call could loop indefinitelyunrecognized character after (?Psyntax error in subpattern name (missing terminator)two named subpatterns have the same nameinvalid UTF-8 stringsupport for \P, \p, and \X has not been compiledmalformed \P or \p sequenceunknown property name after \P or \psubpattern name is too long (maximum 32 characters)too many named subpatterns (maximum 10000)repeated subpattern is too longoctal value is greater than \377 in 8-bit non-UTF-8 modeinternal error: overran compiling workspaceinternal error: previously-checked referenced subpattern not foundDEFINE group contains more than one branchrepeating a DEFINE group is not allowedinconsistent NEWLINE options\g is not followed by a braced, angle-bracketed, or quoted name/number or by a plain numbera numbered reference must not be zeroan argument is not allowed for (*ACCEPT), (*FAIL), or (*COMMIT)(*VERB) not recognized or malformednumber is too bigsubpattern name expecteddigit expected after (?+] is an invalid data character in JavaScript compatibility modedifferent names for subpatterns of the same number are not allowed(*MARK) must have an argumentthis version of PCRE is not compiled with Unicode property support\c must be followed by an ASCII character\k is not followed by a braced, angle-bracketed, or quoted nameinternal error: unknown opcode in find_fixedlength()\N is not supported in a classtoo many forward referencesdisallowed Unicode code point (>= 0xd800 && <= 0xdfff)invalid UTF-16 stringname is too long in (*MARK), (*PRUNE), (*SKIP), or (*THEN)character value in \u.... sequence is too largeinvalid UTF-32 stringsetting UTF is disabled by the applicationnon-hex character in \x{} (closing brace missing?)non-octal character in \o{} (closing brace missing?)missing opening brace after \oparentheses are too deeply nestedinvalid range in character classgroup name must start with a non-digitparentheses are too deeply nested (stack check),\K<^KlKlK,^KlK\P{Ll}\p{L} \H\p{Xsp}\p{Xwd}\p{Lu}\P{Xsp} \p{Xan}\b(?<=\w)@`  @ hkKnKlKlK$\K<^K]KlK<\KXkK\K]KlK,\K ^K,^K\p{Ll}*+,-789:DEFGQRST^_`ajklmAnyArabicArmenianAvestanBalineseBamumBatakBengaliBopomofoBrahmiBrailleBugineseBuhidCCanadian_AboriginalCarianCcCfChakmaChamCherokeeCnCoCommonCopticCsCuneiformCypriotCyrillicDeseretDevanagariEgyptian_HieroglyphsEthiopicGeorgianGlagoliticGothicGreekGujaratiGurmukhiHanHangulHanunooHebrewHiraganaImperial_AramaicInheritedInscriptional_PahlaviInscriptional_ParthianJavaneseKaithiKannadaKatakanaKayah_LiKharoshthiKhmerLL&LaoLatinLepchaLimbuLinear_BLisuLlLmLoLtLuLycianLydianMMalayalamMandaicMcMeMeetei_MayekMeroitic_CursiveMeroitic_HieroglyphsMiaoMnMongolianMyanmarNNdNew_Tai_LueNkoNlNoOghamOl_ChikiOld_ItalicOld_PersianOld_South_ArabianOld_TurkicOriyaOsmanyaPPcPdPePfPhags_PaPhoenicianPiPoPsRejangRunicSSamaritanSaurashtraScSharadaShavianSinhalaSkSmSoSora_SompengSundaneseSyloti_NagriSyriacTagalogTagbanwaTai_LeTai_ThamTai_VietTakriTamilTeluguThaanaThaiTibetanTifinaghUgariticVaiXanXpsXspXucXwdYiZZlZpZs          / _ 0 M=%N+\19B]IQZ`bvB}_C  >   O%.29AHQPblQRSTD !E"#U  FG$'^/ 2 5VB`Sahbm p%z& '?(H)*WX+,@AI -&(Y2J=@cH.P/X[^adnKx01234Z[e56789:;L <   ( ) SDSOFTWARE\Classes\\CLSID\\\IPC$This is a third-party compiled AutoIt script."runasError allocating memory.SeAssignPrimaryTokenPrivilegeSeIncreaseQuotaPrivilegeSeBackupPrivilegeSeRestorePrivilegewinsta0defaultwinsta0\defaultComboBoxListBox|SHELLDLL_DefViewlargeiconsdetailssmalliconslistCLASSCLASSNNREGEXPCLASSIDNAMEXYWHINSTANCETEXT%s%u%s%dLAST[LASTACTIVE[ACTIVEHANDLE=[HANDLE:REGEXP=[REGEXPTITLE:CLASSNAME=[CLASS:ALL[ALL]HANDLEREGEXPTITLETITLEThumbnailClassAutoIt3GUIContainer`EACCCEҴCմCմCHEACCCCE$C^CCCHEACCE^CC`EACCEHEACCCCECExE^CѾE+CCXC,CHEACCCCfCQE`EACC,ECCCشCREOCCCACAC1E0EGCCCnCECսECWINDESCRIPTIONDESCRIPTIONSOURCEHELPFILEHELPCONTEXTLASTDLLERRORSCRIPTLINERETCODERAISECLEARSTOPE I|K|K|K|K|K|K}K0}K@}KL}KX}KEnEEoEE)EE@COM_EVENTOBJE]EDEOE0EEsEDllGetClassObjectEEEEEEEcdeclnonebytebooleanboolshortushortworddwordulonguintlongintvariantint64uint64floatdoublehresultstrwstrbstrptrhandlehwndint_ptrlong_ptrlresultlparamuint_ptrulong_ptrdword_ptrwparamidispatchobjectstructclsidInterfaceDispatchQueryInterfaceAddRefRelease   $H0~K<~KH~KX~Kd~Kp~K~K~K~K~K~K~K~K~K~K~K~K KK$K0K<KDKTK`KpKKKKKKKKKK$KEEE EEE,E$()*+%s (%d) : ==> %s.: %s %s Line %d: Line %d (File "%s"): Error: . ^ ERROR Error: %s (%d) : ==> %s: %s %s Run Script:AutoIt script files (*.au3, *.a3x)*.au3;*.a3xAll files (*.*)*.*au3#include depth exceeded. Make sure there are no recursive includesError opening the file>>>AUTOIT SCRIPT<<<Bad directive syntax errorUnterminated stringCannot parse #includeUnterminated group of commentsONOFF0%d%dShell_TrayWndREMOVEKEYSEXISTSAPPENDblankinfoquestionstopwarning Line: BUTTON#32770\\?\\\?\UNC\\\.\StringFileInfo\\VarFileInfo\Translation04090000DefaultLangCodepage%u.%u.%u.%u\*.* alias PlayMestatus PlayMe modeclose PlayMeplay PlayMe waitplay PlayMeSeShutdownPrivilegeMIDDLEMAINPRIMARYMENUSECONDARY nul0x%pTrueFalse%4d%02d%02d%02d%02d%02dDefaultw+bEA06autwbFILE"%s" (%d) : ==> %s: %s %s "%s" (%d) : ==> %s: ^ ERROR %4d%02d*.*..LPTallcdromremovablefixednetworkramdiskunknown:\closeclosedopen type cdaudio alias cd waitset cd door waitclose cd waitPhysicalDriveRemovableFixedNetworkCDROMRAMDiskUnknownSSDSCSIATAPIATA1394SSAFibreUSBRAIDiSCSISASSATASDMMCVirtualFileBackedVirtualREADYINVALIDNOTREADYREADONLYUNKNOWN%lu\??\%s.lnk.*RANOCT6QB~ۜC]_GUI_RUNDEFMSG<local>EnvironmentDISPLAYmsctls_progress32AUTOITCALLVARIABLE%d, $^[A-Z\d_]+$Ping255.255.255.255Int32Int64DoubleStringArrayDLLStructReferencePtrObjectBoolKeywordBinaryFunctionUserFunctionMapNULL Pointer assignmentIncorrect Parameter formatAUTOIT.ERROR_NewEnumget__NewEnumNull Object assignment in FOR..IN loopIncorrect Object type in FOR..IN loopNot an Object typeFailed to create objectInvalid parameterGetModuleHandleExWCALLARGARRAYVariable must be of type 'Object'.Variable is not of type 'Object'.%@Incorrect parameters to object property ! %.3d%S%M%H%m%Y%jX86IA64X64WIN32_NTWIN_10WIN_2016WIN_81WIN_2012R2WIN_2012WIN_8WIN_2008R2WIN_7WIN_2008WIN_VISTAWIN_2003WIN_XPeWIN_XPInstallLanguageSYSTEM\CurrentControlSet\Control\Nls\LanguageSchemeLangIDControl Panel\Appearance3, 3, 14, 0USERPROFILEUSERDOMAINUSERDNSDOMAINGetSystemWow64DirectoryWSeDebugPrivilege:winapistdcallubyteGG64HKEY_LOCAL_MACHINEHKLMHKEY_CLASSES_ROOTHKCRHKEY_CURRENT_CONFIGHKCCHKEY_CURRENT_USERHKCUHKEY_USERSHKUREG_EXPAND_SZREG_SZREG_MULTI_SZREG_DWORDREG_QWORDREG_BINARYRegDeleteKeyExWadvapi32.dll+.-.-(*UCP)\XISVISIBLEISENABLEDTABLEFTTABRIGHTCURRENTTABSHOWDROPDOWNHIDEDROPDOWNADDSTRINGDELSTRINGFINDSTRINGSETCURRENTSELECTIONGETCURRENTSELECTIONSELECTSTRINGISCHECKEDCHECKUNCHECKGETSELECTEDGETLINECOUNTGETCURRENTLINEGETCURRENTCOLEDITPASTEGETLINESENDCOMMANDIDGETITEMCOUNTGETSUBITEMCOUNTGETTEXTGETSELECTEDCOUNTISSELECTEDSELECTALLSELECTCLEARSELECTINVERTDESELECTFINDITEMVIEWCHANGEGETTOTALCOUNTCOLLAPSEEXPANDmsctls_statusbar321tooltips_class32%d/%02d/%02dbuttonComboboxListboxSysDateTimePick32SysMonthCal32.icl.exe.dllMsctls_Progress32msctls_trackbar32SysAnimate32msctls_updown32SysTabControl32SysTreeView32SysListView32-----@GUI_DRAGID@GUI_DROPID@GUI_DRAGFILEError text not found (please report)DEFINEUTF16)UTF)UCP)NO_AUTO_POSSESS)NO_START_OPT)LIMIT_MATCH=LIMIT_RECURSION=CR)LF)CRLF)ANY)ANYCRLF)BSR_ANYCRLF)BSR_UNICODE)argument is not a compiled regular expressionargument not compiled in 16 bit modeinternal error: opcode not recognizedinternal error: missing capturing bracketfailed to get memory=>?p@@AC BKKK-L B-L B,BC3B0=BH?B\?BEBHBIBJBKBKB,SBTBVBXB\B]B]Bi}B}}BBBB^BjBΚBݚB›B3BiB|BBB֦BBB1BcBB|}BGBBC C-CCC9CJ=C=CACPC~C L 4 l ڮ P ܯ  F D l |L  α T 8 P, T d, d   ȥ T  (ԩ  x f V F 4   $ 8 N n ~  * 4 B ^ " v   ( < P p Ư ~ p  * : H f Z N D T ` l x 8 , Գ   2 < L ^ n | Ĵ ڴ  0 > P f z ĵ ص   , : P : n ¶ ζ ( 8 H X j ̷ ܷ   . < R d v ʸ  > ` z Ĺ Թ  ( : P ` l ̺ ں   , 8 L d z Ȼ ػ &   в x ` t f R   2 D N Z f v   $ 4 F R b | b  0 &'%) M x j R < (  h ~   . @ N \ h |   $ 4 @ L ` l x   " 0 : R ` v  | h X J ^ $  , r ^ J < .  ޿ п t j Z L 8 ,   Ծ t ^ J 8  ڽ ʽ | b H 2  J 8  t d P 4 > μ ¼ | j V J < (    (  ܱ D r X N N d t ܰ   & : Ȱ Ʈ t  s o 49   ( @ V n  0 l V > WSOCK32.dllGetFileVersionInfoSizeWGetFileVersionInfoWVerQueryValueWVERSION.dlltimeGetTime2mciSendStringWwaveOutSetVolumeWINMM.dll{InitCommonControlsExSImageList_CreateoImageList_ReplaceIconTImageList_DestroymImageList_RemoverImageList_SetDragCursorImagePImageList_BeginDragVImageList_DragEnterWImageList_DragLeave^ImageList_EndDragXImageList_DragMoveCOMCTL32.dllWNetAddConnection2WIWNetUseConnectionW WNetCancelConnection2W$WNetGetConnectionWMPR.dllkInternetCloseHandleInternetOpenWInternetSetOptionWtInternetCrackUrlWZHttpQueryInfoWInternetQueryOptionWrInternetConnectWXHttpOpenRequestW^HttpSendRequestW5FtpOpenFileW2FtpGetFileSizeInternetOpenUrlWInternetReadFileInternetQueryDataAvailableWININET.dllGetProcessMemoryInfoPSAPI.DLLIcmpCreateFileIcmpSendEchoIcmpCloseHandleIPHLPAPI.DLL!LoadUserProfileWCreateEnvironmentBlock,UnloadUserProfileDestroyEnvironmentBlockUSERENV.dll?IsThemeActiveUxTheme.dllInterlockedIncrementInterlockedDecrementDeleteCriticalSectionInitializeCriticalSectionAndSpinCountRaiseExceptionGetLastErrorDecodePointerElstrcmpiWGetCurrentDirectoryWIsDebuggerPresentMSetCurrentDirectoryWGetFullPathNameWRCloseHandleGetCurrentThreadGetCurrentProcessDuplicateHandleCreateThreadWaitForSingleObjectHeapAllocJGetProcessHeapHeapFreeSleepGetCurrentThreadIdgMultiByteToWideCharfMulDivGetVersionExWIsWow64ProcesssGetSystemInfobFreeLibrary<LoadLibraryAEGetProcAddressXSetErrorModeGetModuleFileNameWWideCharToMultiByteHlstrcpyWNlstrlenWGetModuleHandleWQueryPerformanceCounterVirtualFreeExOpenProcessVirtualAllocEx.WriteProcessMemoryReadProcessMemoryCreateFileWgSetFilePointerExSSetEndOfFileReadFile%WriteFileWFlushFileBuffersTerminateProcessCreateToolhelp32SnapshotProcess32FirstWProcess32NextWjSetFileTimeGetFileAttributesW9FindFirstFileW.FindCloseGetLongPathNameWaGetShortPathNameWDeleteFileWEFindNextFileWrCopyFileExWcMoveFileWCreateDirectoryWRemoveDirectoryWSetSystemPowerStateQueryPerformanceFrequencyNFindResourceWALoadResourceTLockResourceSizeofResourceEnumResourceNamesWOutputDebugStringWGetTempPathWGetTempFileNameWDeviceIoControlGetLocalTimedCompareStringWEnterCriticalSection9LeaveCriticalSectiondGetStdHandleCreatePipeInterlockedExchangeTerminateThread>LoadLibraryExWMFindResourceExWuCopyFileWVirtualFree^FormatMessageWGetExitCodeProcessBGetPrivateProfileStringW+WritePrivateProfileStringW@GetPrivateProfileSectionW)WritePrivateProfileSectionW?GetPrivateProfileSectionNamesW$FileTimeToLocalFileTime%FileTimeToSystemTimeSystemTimeToFileTimeFLocalFileTimeToFileTimeGetDriveTypeWGetDiskFreeSpaceExWGetDiskFreeSpaceWGetVolumeInformationWSetVolumeLabelWCreateHardLinkWaSetFileAttributesWCreateEventWYSetEventGetEnvironmentVariableWWSetEnvironmentVariableWGlobalLockGlobalUnlockGlobalAllocGetFileSizeGlobalFreeGlobalMemoryStatusEx6BeeppGetSystemDirectoryWHeapReAllocHeapSizeGetComputerNameWGetWindowsDirectoryWGetCurrentProcessIdNGetProcessIoCountersCreateProcessWLGetProcessId}SetPriorityClass?LoadLibraryWVirtualAllocKERNEL32.dllDestroyIconMessageBoxA-GetForegroundWindow|GetSysColorBrushLoadCursorWLoadIconWMRegisterClassExWnCreateWindowExWShowWindowSetTimercRegisterWindowMessageWkCreatePopupMenuKillTimer7PostQuitMessageSetFocusMoveWindowDefWindowProcWMessageBoxWGetUserObjectSecurity-OpenWindowStationWhGetProcessWindowStationSetProcessWindowStation(OpenDesktopWNCloseWindowStationJCloseDesktopSetUserObjectSecurityGetWindowRect6PostMessageWMapVirtualKeyW|SendMessageW&GetDlgCtrlIDdGetParentGetClassNameW;CharUpperBuffWEnumChildWindows{SendMessageTimeoutWmScreenToClientGetWindowTextW,GetFocus AttachThreadInputGetWindowThreadProcessIdGetWindowLongWInvalidateRectEnableWindowIsWindowVisibleIsWindowEnabledIsWindow#GetDesktopWindowEnumWindowsDestroyWindowKGetMenuGetClientRectBeginPaintEndPaint!GetDCeReleaseDCUCopyRectSetWindowTextW'GetDlgItemsSendDlgItemMessageWEndDialog MessageBeepDialogBoxParamWLoadStringW!VkKeyScanW=GetKeyStateBGetKeyboardStateSetKeyboardStateGetAsyncKeyStatevSendInput0keybd_eventSystemParametersInfoWFindWindowWIsIconicSetForegroundWindowTGetMenuItemInfoWSetMenuItemInfoWQGetMenuItemCountRGetMenuItemID@CheckMenuRadioItemDeleteMenu GetCursorPosTrackPopupMenuExIsMenuInsertMenuItemWSetMenuDefaultItemEnumThreadWindowsFindWindowExWSetActiveWindowExitWindowsEx1mouse_eventfCreateIconFromResourceExLoadImageWMonitorFromRect-CharLowerBuffWUnregisterHotKey3PeekMessageWTranslateMessageDispatchMessageWLockWindowUpdate]GetMessageWBlockInput&OpenClipboardIsClipboardFormatAvailableGetClipboardDataICloseClipboardVCountClipboardFormatsEmptyClipboardSetClipboardDataSetRectAdjustWindowRectExTCopyImageSetWindowPosGetCursorInfoVRegisterHotKeyGClientToScreenAGetKeyboardLayoutNameWIsCharAlphaWIsCharAlphaNumericWIsCharLowerWIsCharUpperWXGetMenuStringWzGetSubMenu GetCaretPosIsZoomedMonitorFromPoint_GetMonitorInfoWSetWindowLongWSetLayeredWindowAttributesFlashWindowGetClassLongWTranslateAcceleratorWIsDialogMessageW{GetSysColorInflateRectDrawFocusRectDrawTextWFrameRectDrawFrameControlFillRect@PtInRectDestroyAcceleratorTableXCreateAcceleratorTableWSetCursorGetWindowDC~GetSystemMetricsGetActiveWindow1CharNextW3wsprintfWJRedrawWindowDrawMenuBarDestroyMenuSetMenuGetWindowTextLengthWjCreateMenuIsDlgButtonCheckedDefDlgProcWCallWindowProcWdReleaseCaptureSetCaptureUSER32.dllGetDeviceCapsDeleteObjectGetTextExtentPoint32W/CreateCompatibleBitmap0CreateCompatibleDCwSelectObjectStretchBltGetDIBitsDeleteDCGetPixel2CreateDCW GetStockObject$GetTextFaceWACreateFontWSetTextColorTCreateSolidBrushKCreatePen~SetBkColorjRoundRectSetBkModeGetObjectWSetViewportOrgEx_RectangleBeginPathPPolyDrawEllipse:MoveToExAngleArc6LineToCloseFigureSetPixelEndPathStrokePathStrokeAndFillPath2ExtCreatePenGDI32.dll GetOpenFileNameWGetSaveFileNameWCOMDLG32.dllaRegOpenKeyExW0RegCloseKeynRegQueryValueExW4RegConnectRegistryWwInitializeSecurityDescriptorvInitializeAclAdjustTokenPrivilegesOpenThreadTokenOpenProcessTokenLookupPrivilegeValueWDuplicateTokenEx|CreateProcessAsUserW}CreateProcessWithLogonW6GetLengthSidvCopySidLogonUserW AllocateAndInitializeSidQCheckTokenMembership FreeSidZGetTokenInformationHGetSecurityDescriptorDacl$GetAclInformation#GetAceAddAceSetSecurityDescriptorDacl}InitiateSystemShutdownExWeGetUserNameW9RegCreateKeyExW~RegSetValueExWORegEnumKeyExWDRegDeleteKeyWHRegDeleteValueWRRegEnumValueWADVAPI32.dll"ShellExecuteW.Shell_NotifyIconW*ExtractIconExWSHFileOperationWSHGetFolderPathWSHGetSpecialFolderLocationSHGetDesktopFolderSHCreateShellItem{SHBrowseForFolderWSHGetPathFromIDListWSHEmptyRecycleBinWDragQueryFileW!ShellExecuteExW DragQueryPointDragFinishSHELL32.dllgCoTaskMemAllochCoTaskMemFreeCLSIDFromStringKProgIDFromCLSIDCLSIDFromProgIDGOleSetMenuDescriptorMkParseDisplayNameFOleSetContainedObjectCoCreateInstanceIIDFromStringyStringFromGUID2CreateStreamOnHGlobal2OleInitializeIOleUninitialize>CoInitializelCoUninitializeGetRunningObjectTable-CoGetInstanceFromFile5CoGetObject@CoInitializeSecurityCoCreateInstanceExcCoSetProxyBlanketole32.dllOLEAUT32.dllEncodePointerExitProcessGetModuleHandleExWExitThreadyGetSystemTimeAsFileTimeResumeThreadGetCommandLineWIsProcessorFeaturePresent IsValidCodePagehGetACP7GetOEMCPrGetCPInfosSetLastErrorUnhandledExceptionFilterSetUnhandledExceptionFilterTlsAllocTlsGetValueTlsSetValueTlsFreecGetStartupInfoWiGetStringTypeWSetStdHandleGetFileTypeGetConsoleCPGetConsoleModeRtlUnwindReadConsoleWGetTimeZoneInformationGetDateFormatWGetTimeFormatW-LCMapStringWGetEnvironmentStringsWaFreeEnvironmentStringsW$WriteConsoleWVSetEnvironmentVariableA?powlogatanacosasintancossinsqrt@BL@BL        ! 5A CPR S WY l m pr   )     abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZK`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~C/I/I/I/I/I/I/I/I/I/I/I/I/I/I/I/I/I0I0I0I 0I0I0I0I0I 0I$0I,0I80I@0I0IH0IP0IX0I`0Il0It0I0I0I0I0I0I0I0I0I0I0I0I0I0I0I1I1I(1I<1IP1I`1It1I|1I1I1I1I1I1I1I1I1I1I1I1I1I1I2I1I2I2I(2I82IL2I\2Ip2I2I2I2I2I2I2I8KKKKKKKJ J JK8KKJb\Cb\Cb\Cb\Cb\Cb\Cb\Cb\Cb\Cb\CN@Dus@I@I@I@I@I@I!@I@I @I@I@I@IAIAI AI AI AI AI(AI0AI8AI@AIHAIPAI"XAI#\AI$`AI%dAI&lAID0 BI BI??pPSTPDTK8KK.K=L=L=L=L=L=L=L=L=LK=L=L=L=L=L=L=L.JJ5 @ @@@@ @P@$@@ @4@N@ p+ŝi@]%O@qוC)@D@<զIx@oGAkU'9p|Bݎ~QCv)/&D(DJzEeǑF e uuvHMXB䧓9;5SM]=];Z] T7aZ%]g']݀nLɛ R`%u?q= ףp= ף?Zd;On?,eX?#GGŧ?@il7?3=BzՔ?aw̫?/L[Mľ?S;uD?g9Eϔ?$#⼺;1az?aUY~S|_?/D?$?9'*?}d|FU>c{#Tw=:zc%C1‰|3m<A2|ްC&? AXw7#ɐ ?ݻf^K"~9ПlJ{AEcמ9Cy~e;W2~IՀ\|`mcd {\E&I3{{{-HGyl4^1\pi->c (NIIzI@ɻ_9kw{S)W/J~dZ9 Rc%ko<·_]s,U<ΕFp47׻shwlR5h[dlF.o nz< 1wdZd,F%/p,p5N9e Ljc}yu&ռX FǮT-DU'~Vwa2ED EAM% ?Nxy` $̛XXb<<|ḝ&VT͔=!Yf+y;o؂cpo:*ãxj6LJtC+#0(x]O2J4we(Z!fSQje8tl0L}߅Yc?AdHwm$N9w2a"UШ \t7"RE>ǍzUbfLJ'L8  7@qH)V'5Ȥc|g#XSP1bƨ[jxKdđW2N(,8Ed>('3r'e ʈ Lq|)t|WJ ,:}e:F$K7 ̓a%U#+.5ٴ[X,ö-0)DkR 4i] ױ跊ۊBWx:hNu N] &"GYv''Uz#:l06'-"3,seYtj v+k9R`ѱn4"4ǒYvStv$I5ѻ5Mz%"PHQw鏃4؛310 J3rC2m)+$逗o,y~pPHXmZPBEi4 VXdrh?hkYlt'h0B T9J\|ZSG&y^N `,z.Ј,6X!u&z2ԐT v]!`Ӝt} 2B==SD;J.-_ՖABw HchZET=K4d==H$HቷsӮOqY!rδEm 9 Lď0\ɴ>Aq@ =3E0׃Ŕősk/ыm[>>#G(ˊjyReU?x܎|OԵ\596;mmG,䤨mBK&׍Ar@1F1xFn9q TOIetWl* XkOJX 4%7lE_]*X֗> -bmPxY9v|"L H" @ ]i#W1!`˥$ X ?ﴳ*tE$NĄ@WX7MQ%R_ O mT}p՜;#b_m8Euo0,vN7LCrXLcE0=v8K!sdY,w @͍ۑ쓠ݢ1M80Ne#%,+C5U z(W: D 8NlGOxA$G-o}BFuM3gR x vzOMS.KQ`9@Vv9q'B^||Bp`q47JN{:?KL9{LrBӓrwyMOBȃNA< :<CbG{!#,ʪC 'E *9M% M_^pW

y$f!](π$;v>:5PwlR/$9.`ѕg8)(-|74gqs@[7k@2t@S_BPY*h?M"X\. w:0Lx2OhY89d8@q+R F(Lq_}-"7W!ȕyX"$4-Rt<!6Q(SjlP( ?6߫tUx"ƍ@a}J%7 :2O@a~<< jtKXN074E5CTX4D&OP!*MdLkǏIS;d<|uV rFFF@ZsRG}f|ErwE@+M:"ԭШK# $str #9eGszr,^X"`Q1.ZZ9$ d {ȈDv ȵjp /`nx]'Ǐ$ MWx$RJNX8Od8pNA(Ff} XYfL@/xs .>UX.RI:xe<(="p'3) ҷ!=9 8$ @e~ d :a j+ eH_/-6WT6>dz%0=WfVE8M8pE52w@q6Śda"IWK6ZX~NՄix&@Ғ uC[lZG;'`}yfu\yA t@bc7mfT?S& GB0I1C(`oV 0/O@. F$;4ph]L ^.uF*-X,)mͣM5_&71|26 pD"x.r ~x]?籌r[ԩ ȔhL\E+j'm "E*`w@3s]Lg#PU2=;fzhjӵx*MMaU~\^ǂ7yflF5&]Oe Y\zGcVedUK6t { _Y`@f`B>KMtMX3*A0={3 .V1wҤ> fϟo8*QS }[;,3j+u9c1WPc!$Ӫ}Y=P9Uu0 Lc`׵c-/]Qữ]Uy?|ZjMK M=0G0J|\* 7{OzE}_ HKIZm+.MP;*dP25_ռV\@,E{8@L| Xmz]E]:4$L 77iz # {glV5aopCn<St\ %Z3zK.`;IA* >?4 ? Eڰ䧕7mx֍$pڎ'i+*U ln)(pդnr D'B{,+2Єv}37: MVIm?{[q'/$AtN}0t.z8͹#:Q+w3gff>,m۟ Fhd[q9y3" [:$Nj-+s/$"<U?[ @{,w `-WPkxFk4Ӊ #Pq@ (YU n ~*]  #hث`2="x_{,3>j 7{eJJ` B> nFǓ$±0 pض+w7gxxxGmYJK[ul$DT~vU$ BֿeVBe!$*Ap3U%[tq]euN5'[݇d;ƽl-P*p,& NT$/H,Ț&5ݮr dlMu1c0NbVp_?{ j,^gK]7z79߁?g2X9뇾QUrtʹaV@vZ~n=IENDB`PPNG  IHDRkXTPLTE Jx)C;_ f7Y!{ [ S'@ Q ^%< b&0x~u L{"7 W+w4T0N jq OBj   Gs ?e.Jo  m,H>dEo 2utRNS7(7;#$D'  J<45+3? %?sZ02؇n{㷫ԏٹ^uĠ˸ͺƠӭ>‚s~~i]r\ok]yŶWFXH %P^fMS|g/bsqlt\{jqOIhaT>N8WJtRd2V$7H $?E*#5/FA)@7+:0-D IDATx} L{ y"(BE @)@f($"%CEs30#o\ 'cgrDx8 mo^kӟ=?~ɳ{CFӮU!dH~Ǐ{ϭϝ6_>i0$ִth֥*h2,Yē&Ʀ? Fڱ?Ҿ{-r.ǿV(T$:T:֨mk9}bL4L}/pOO=FlӿN?>>qatOPSU'*kե(-475iWTCLћG>葬zft~hD^U*բH7W?=aXL &qx|{{gTaBI2ShʛCY)I4%fH~L&Arpp,jlmݛd.a-76wKNOL+r2 |.$`tI *w渊ei:ޤ=ycoЖ~|)ARFSʠK yQ:p:WJ.qz RۆE޺5vMuf/MCΩ9)CP,z6[kL+ ϝ&7!D0L(<_T^4P}VB??P)4{qXlҹ5Iqw&_Y4{u ?QGegYSܠ?4YꪴGZikOQxv*™OU3Nu`]+OGrs3BPgdvfW>qڡC2%nl4!tٳȚm5d;9D*y:߿5r7{= l0 B"rYG}ց0Y{ λ عʴ!F{GDȌ6g?F)|I]V$`eȹS:l^!F7R'T:SpT-]ʛ|cekχ* H`?{>yFT3%E00 0~JCjA`S~UN4S>]Q[}GZkY7o_idžok~Lg8!pJ[ޘ?ɼԥ=S1+ lf5Cpe<~*Wgvޠ.;UM1/Yex&vY9HKqʸkk-޲zKTmbBHFjE^G!J$3Al5 8dkz^,]K:w6~9r:3K/ٺsےZ:3vȯK h =PdI6j >IʳWC(O-njUE \M9xfX! M]mBgX|gfR5jg!dڋ Žobl=d`Zw.Z(9"zdNaGIftEQM!UfB$ ue7@ɱ[7B*"5Lϡ:WaFY3(LPh.ud<- V3 N=V Jlug@fa$N&#=/1 A9)C۬m~Q\G$ȼWaK܈v 8Bh5jA`OMl ~tC?@{H.(uqm[cdiMZ60B +yEw( <ɚs 7er| 1HG!; 5ۦ~Y<{T^>g;>`YSkJ.D5'}V%#~l\H!<#d#t]|",[vm`l ' ȏz]n*MYR@ͯXq x\BufUߴ)h8΄1N] e3/xΥU|͉}:g3,Hz1'W9b|½r舐癒7HF{Sޮ&k83ib'0grDBYl CN {3+\%5:\(aUOi %.3 F SR/\ K9 C $_VY rWⰉ98T1nw;λ8;}<ڥgD\Uj/:L`1- Xv<>)?.'0-c{g {^ޑMWCGA~~![wڮfKh\bQrE-ӑb|[5f$oMV6v]:ZstC褘YoųU6zsgHsdS#^Ƈn0AbՁB* .S[ZVOONEr*O?.u r10#a%?UJA Fj~Drř]F eOar#1ZEL)1i~Q0QH"lOaIPzNCR$5-E@QqŪhzu#꟬kQұW8><(W."3l7='w׭ ?'$BGr]^4CzmP:y@QTSPW\O{'[7uB*h Om{:2 suckYU@JW )0JڳmpYB2 .ˆ'+!?T{ gRq 1~欬;[kQaSl{>ݩGt/ =B\X]ߗ ?1JQ(Qwj+$woS}_*v籂9OyN9%č2cn*v)2HΎ }aЖ80F9q  8ޜN׌~/]8&O8&mz6EDbaO=7daO 1-xM_vD`"X)4].;G!~:O=)yk(D>t{w*w"{0DG٨J!]σⳔg;`\X _>{4(*p<ߊ){%E@Hveq}d+d)e,B3(%1duj@@p˰@+9cdFMt&6=ҝaÙ*:3gt~y s!V?{r^|d]6Ѩ(~{YNE. !a'ZOh/Bp"<@p_h-5pc@joM.-N3eEI2tLe%4(IU_cNK9_զ{įMzc|f2$Y!{PwSUn>F;,#qHn:}Ҡ5Wm}oMeIH`"q?-^}-0s׋1&a.N7=}I^)^~P=L@WID4]qV$ݟg{Uވw~9\.!/4ݓn(Qb!;K}Oͤ#BmoTO^82ddkU)cV$xb#B{߸lL sWϸFyUMIuN@}}'GJ@"`G:5# ޾-OFIٜ1ڮZ3Z.9+ 72M]#LF*tqVW[mDmu؎cBcªioɫ*UN"o|!R2a'nDo܈ڽ%O~^Qq g+Ћo74 NnUU蹔;k(L'EYphp-z]mwR[9a+˝0 %z'3𧦳:ZС0w:KhKf*ԺkVߏJnG)ֽ֦։νe,` É{9[Kb+GgIz1 ζ'#[yIErJ{G(ƕ,~,~kj(^ 4F˳48 ] Ib?1\-7([e4Na$K$.,b]pR!$$M wļ4JԞ\_&d}Z'# cOAmRׇo[~I&crݳW4K@<!^['%BF@mFIeOw'!ūn?YG F#d ^b p`uib]#}?Z aYr?-rsY@%?٠BU挾OH&~ wsu'&mp}4>N/'3@ U}Zq7;E6~7R,".Uڪq ewx (j^Z^ʞH_w69uE="ߺg% 9`pJ닰q_R'b4;T:3 rsp:gۣ{[qǑlE@l o9B2s+H >wlRF"E-QՊ#lCɍGvϻ^\2;48:]}w*PjH_dL, 9I pv4ؔCF]> j;lcgA'RS0!S{< !fgtn^Ε`%l7ɪ`g396N]wSټ;J4y"XG>xnt)E$`gLOipUaBjK'L{\@8>sp ȵaZ|i< PTy//mT>w` LO+f QHj LnJaʔ8}gyYyE@hCcQA?<3]x q?LN]Lg_Lnv4  GK*bH &yJɠ.ܺOxW)B+8"+rGut 8^=p&`:Y0?96f$&Nm Ө8dJ*2vmA/MM5ty\zjyxc6#F6qjh+JyzE&H,C.?rېe`. ^rm ETq8'a 'e>yhk ɐC3#|R]Z.DFrOrUGCdӏ-xe;w:M1S&ϗe~{D~DZ$ ۳Ov }9𗗤 ].{U(oK Ke ڬ;[SY.(J,ͩby;0%,m1$M}bh0ȽO@TmޮNg-3죻o4{nO+)U4ل!Ba$ atb>h̡^+&C%GIDAT?:.KA[ǰm"[e@h1|U/sd7!X|tz~]W Y̪['̥O:۶NS:3u+i ъ `\ b pu%#w".]BgLXkW(8}k2[dw_h̦0WV}y϶̓[Ԁ#;ߧ/0V<|@ҿ&i񀼎'\gHιIS(ՖUN=馿i%oUd@>O8:aB5{/4-׹ttW}6.dbP\;Ʌ2`V#<2]9h}/W̥Vli 3]#ӴYo! G|P8t6Õ˒\[ 0n'DE1暝6%Nf  TIսV'Ÿa8v,za[{ʼn@h4fnDup]$ ڠ>E>C | FX` *;GJ jgX}Efmt"%mo6e1*E:ԑF^cO{,٠H͊譠/8Vf\`^U%D9B6Tȍ]de_xgQ)tU߻E*R2qO2u&{y-fU9N*ll֛'H]kζTh}s&{tc)a3z(Ba[ӻ-Jqr%J*PԘ7BO"Hx)`GMK`T\fr&ӖFA%-huKtTS"N>3՟cM35o{ݑl aBcj$wK'49" ˑWDn&3unm?{ٍשOE^ݽˀGSEVݭaŽij!I#H'b^9_G d)]ҪFwKr+ς4ꦩCNG S .G|Y͇N=Z#rF|\YHb~⎉CQL&p,4;R녻Hϭ `>}{z'OVesP V[pyTvHbM[VqCZ߬0)V+{UzJ!0ɬ + QY~ 7XT!k ͗?೐,gBtj= "~@]oDm9GxEĨMʼ /sο m 0*.Wy(90 wT,R| k{Oj@sg:e!/A%5@owoğ{)LnbrJiP޷{Tzfp&t?WC&C]jN73ښ`5vr,{;4jVj$ =^+KF8 Mkz1qXV+PcwhT|!^ ]ҍ:Ui/ʕ P7~~YedS:կ]>y;o*HF7n GUK#LM\?-BⰸRsaRg91G@^[C ] voMya(EQXg\[y8lt!JPhXƱ@C,Jv ܮcj0#B,EJ֧Wq:pK[<{f15nM/Ҭ<]o;{ar h;{cJ2٤?8}wr cep(g5.S&w9Dr3-9>!2Kv d&SCZgs2_非jP# HN/>Y(BakʊJt%eL#R1'p {g娄9kysw@Fȴpgfbg 8Z*ೌ?ͮde''VyfMw*\Gy U!J6_F4'*N9]ϖU>150 $07E,ݯB 䱿[z/VT`;><сMlЮ=*G< ¥O[Zv8I-HßXYRuVsYl Kp {W@]7WF0+REd}IS<*K` WU'ݽSc+JPTHj,?9ƹ@ J(.ksOӃ2CGs:n} T^Hإv!wEɰ)2LN=Q@Q3i4:{" !+.ʎk 40ΨPw߿Ti.N$pC!;WtZwH(4c:bƣ"}PEi=#Bg ֝7y,3 =o4 3JwԘ09/l;#Ϥ YH@\N=YA޲fN̓C N߼f8tH,1M-w@K4²*Pr+A EPo񔀰gŴ+ʈ߻R]"8zmY T^rgv?HLMќ>wpt՗WcpEa#$ +w.=u*.7N tr@UF9ӪmBE(+R*p, h8ꩼk9`^w.+OPP,z;bvf2A19xllL*~E .Q~١oV1ceMmm礚+'ºwmHtr aPJHW$ՖYug12ٵkjC `L0 Tc{[NZb []STiO*|ۯAF0#?}*mroanLEM醦=CAS2[5 }x>+.CYs N ܺ ybJ%0*у[MAwD gcC`,{t\?B+Cj%YD-G^t@AstΖHfefU& B) k<ܬgf;m@8t\5֩2 PxVy:gu`-cMKK=eg- .k+ g0:Nt,HL+⭀Y݇gV1i^jo!*,+ppf`6I1p$Me5V-H9AH N[! v`tt)#Ljٳ`@΂ /2Du͉x}@p֘`#Zcà w30 $I~@(-hO@w|1VueF<}s%!P M/܍r>DAta|g.ŇZM9;Iˇa ƳΜ鱹M!ILgdf'd|>XRפM+sj%UNPT) 8b:`tMy#4?G]ˀ;ʖr8bvQ8xvМR)L&+ BfPq:b1( :24\u_n~R?6~h?&KPO&B`G:chT*Nd,N`t LzVEi( Y^ԑdxp_Ž`= i%|eTCΤat H'f3t* MBfAL*M2l 4@vKLʕZ8SqxX\&(@t@-@q E\8T &28Ȅ"e]e(k:Ľ+CԠX;"^4\Y^wq=$GT t&sv@&O[$p}%Pb?7 ew;-ͅ+q7x81:w`0?tH͹@ D+M}+kl\_Yƫ)N6PE~@ʥ3bʔGC{x1C[& uW3 %%nNLЖbxl:ǁ)Hg=#0~d/ONdڙ+ gAY촹/%%7?-]ߙdfL{ ĉ;B~<5Z W:rxeq8) fe>;vu!>zt Fi@F#iUJBR!O9;QD]ά+W6d,;O~8. }`DDDļӭr]ZZx4L]&)BEMMs)Nѐ8='%M mƢyԆwNxZ%NO_Oz'sPoihz qab1L>'/?~l~]8wXIENDB`PPNG  IHDR\rf IDATxw6[#B#Db3 FPlɲe+Zdj1Y~|jv3k:K%R̤3ѡůb`=ˉ!ƪe%`tj೺9l,l}5x xR`r} `&|:݁ n%*ywP껒Jj@@ )60Y1-x ဘ ^;D_ > UaFzJܔ{D^/ub,%bUW5+,Y# ncj=ߨ)LG R !k%$(/ |DA8963ufHKώx4k +j`eŒC?4C?j[*V1t&@! 8T_i 2 o,D`@18W)8`2xvgAJM>ɤus3BXVw`mTvwhH Hs6 D @(ե~ GZ~ ߏ"q#R3jRO b[@a Ӵ߾Υ?%kK uS{ 'ljbF J6EmUM$M bʂ=%mRBi@ ! Hρ~$Ba,|;|iOן\ xM^"- O=DOUW$-dBQ ́G"mkk$0 v0=Yp~TgGbg!fO EcL9YZ5UgaԳFn1*ׂsGA)Ko?I4D^7͑m`B͂wge}KU+|>)s|xN3xB&)~%e~Si\YiF+== i΃%3ȁzv4 ""H˹1\  7(*AQ)r^??\g1UMIus w[ {tNzH@ ^k II<tI{/= 7 HzJ˄iq B<lwA ާs}j4]?ɼ fM6ؾat333o+LCK܂C©xb8x)jPyM[R|͌FO? y3 b5q"ˬ<xhS rIB)@1=$Y-`4aΏ9(cDdkP9.8y,%am/$%y톬p^g;> +`f}Gq휺aoh$ ڂl@9|6P::d^բy$FsAAj2 F Gdiұ~c&_~6cF0\)J uCA%yud& E>QO看]f nQ%#x]>P@9 DRՂmUgh˄)Ւ+ I Ib2I r C2`qJ2ib &б;ӑeqMpIgEu0B|o& bLJ@&01PĠ/4lajY 5 i U b0A1T!4A70|*t 7g[÷'hi.ɚ3`F3#A3506olQ{{@~3h1ւT}W 5n ̭v$x©L .X 41m\SWi:{_զ-(k@W^7*pbFzp5b.(aJz@L98VDXwR]<p>~̯;79W8SO 4ѣu0mL560n-./bRF(g@ 3Zܳ -aнng#\y T *3f$y*=0O^ho5m@!Lε%eW1f~a 8 ײ:_N<3iTmz.gzY:g$MT Zmvzj| NA?"|:<|_{ڟ7QE{ H_{Iղ@L;=4@L a2( !@>2$Ҍ;ɈDvV1=$)L黿Wf\Q'Kz] x&4l扬ΒՆ}Q>r[@|fТK!JKɳ0f/I2Hς$Н`0>]GC )5 Ogܛĝe=Be4m͜?;:4nESLff4nJæ'A ʒi>o-h@Uiu<13M[4fEo3a{i&;{_k7ԁHm ^h0bh@ؐCC؃ s6ζԔQ)q<+ 2Qɻ?8~ybU)9½q p*%eQR5 4sq,dFI<+Z3TW(N_BXN@q8NҼPh~Ѝ"ƙҹѼqnڗz>+? p!<,*1(j!g*8;۔[@aN ӌ(M.uOg܀}M.f}U5JӖfŸz} i4 '@)x΃@Tqv5\q.W?ũ \ۃkR,>່\s 3s~W7+ mae l4|H eg)ZFyz fH[ۥkPm7}te{ S iFX%R! *ǟ)1glffd74’Fat"Hh1IU`c\'+OXS @/oש;zI.W @9 3@ERvς|Cbp>Af류\Yןpd“ Pք@8 M DM@L$d%%(z.u6UM崾zm㑍LѾ   }*x|Ny7?F]'~wgKo=?uφ]6\;Oݽ254E؆# ]{!.Q@-3:nfzS(Np*k'&L3*h (s M6BvepB\t.zkAuCJM{y0-9超i9L 0O^mӍ}o}+3UvqĽeZw m'/:[ֱnyfZ6;ƃ!eai&BpT 2 쌬IZx rCV/V5P74(-v0#S@a7Zđ}s؟w-cgQίLO a\QP)Y";Ǔ5ErP ehR9Y0=DœQEiƃ]^d״j7ڴ}[}h4@7dDc#޵NbֽZb,D9˜#*s>6ya)GGs sS&ɞڑ fjvDqYL`14ߪ3רm<+Z)lu aBAf!| X-V.W!/_{wI4)KeNzP4TB|Qr;jYu ״ꌾ JSnρ3wAyԗyCo )\S'sN !>wπLr@}y4_@dHĔ@YBj,D V?^s0e h9ےgA> *G]wuǎ7't`( T.33OjjƮr0kdPfR(Ɍ KT95s튾ECFuhg nT1K4{p'W+!|! eT6sxቬԀ|(DNuP Z 3ӂe,Y5-S>ʳ* Zy}6hHPC#o8 p*Z|>;bn'3??Z2$@T}U<&{P2)'4:)O OxsthRmݱ)A>ldJ,y<{_Oz>{*c% OܚmtxE8ӅT@ ȇWjڦ) {V<2 @fFQUi| oF",y((wQ8c}fkN#0^?ƊKn x,yQ l (TABM6$10i.dp*BM)+x]ӷHjZf|^Ș*@$k^O OzpğXbr_ \wxW3C،VD3Mdu/N(!앙Xb @}06= IWª+a g?n]1b<=ѲS-'8RJbA@fF. gzR6BQ 1V$_]ZW1>ۆ"raeN?>o}~n6QW5s)\J\@ΓڨJ{C+ZL@=2H"l r@1O`@?s?8ѫ3:VAV@KZK  i^ݒQSeo- 4q@7KTDQriJ]XuU ??ZTj7xo'A~Dg͠HW'#Dž+pmU,!^V @i1?l0ogfAydKtqn Ďk>HcWIZ{/cZ}~a|2MP7lI9KT# TDgOٟsoEQ)1,YtnViWqW( lW3E^v Ҍ'˲0̈́ڶL_jU6c9 Ϩl${\PesGԽ?ozT纰,U;U6@$ 7d8Sus,QUkۢ4%g<]_27+ wz(ArD 1q/N}\۰us1X3: ؏+G-Fµ _*OUio% Ia(#m ǸMJUsB8}|J28hgAjRm-`r IDATّΕMZ~< }X8+зQP>$mCiy $, }8N  siQs -?uskxYE5 a QQsY*if i>Hg{HiGѫ%QKd jpngS}tv#'HyNO_NbpUKc) yߟ`862QfAY wrހ Puǟ5s>ۿ5o5v+{d B& r} !hukZ#ƪ]K%l}YuA4  fj i$913TKbiw}4P7WA ᬵ97K&^0 o>uXq:}  s@h*ׂh0qWjZ3U/ (/=yK9yjnzTTnhZoڐmpHIg"~~"J3C49%0/^rE-|C8_uơwSol`zr- ?; +iTóp1 ҬώL[`  Ylgh+ J/|w<~zb2_M'^LѾ RgA5{@  NwE?=u㶨ωcm@3LON;x5(8j@8!L9ky:TX'>'ʳOl6/U,jH~(ȱF86IHjp W쳿)Z㙀7xѷ}`(;_>Y߁#VT8π̀f-X_O\4JVĥAFA2H͹j4 |6m}ٟ DogG'@Ӭ/#$}d&( wj(Z$6> /ri_LjԁtSmph7TdsPEPO8Хc|OWT|CkBH䘾{R[>vnc;y2$(0ErXl16P,ך'Ꮒ4K\9ozlxfuNУen|Jm0H?ZHWuڽ}rOӿ, k.Vc Ÿuy+HCX,Cw)|w kp-h @njC&o5DiMsOz׹)8cĈ@e]stU.*=Jk X"[VrS(G:#hڶoTm/qP_r$d (20\pZcs_ws/ rf|gLg `0lƁs)zR2ܻg o(De2qmD C8 @6(h N"?<7qs﷭LӃq4c_6ɰDa=d zJ[x ~\aJ}wc9D3YE*z#7St,e#13ϽqRV)QRDit*W$>E+W[-Is  @ εQҲ4}o5+poueƞo[Iv{;hyp>nO[ @iMխ=P žyLˠb1vw0Vn Ʀm:ƒޯ0xMk%  iQ NT@hA=0`J뎤ZZbm䑮9H[@kf<: hf+~h弁,6fX*c<  ? [?; ߋ3'9oܔVq^_Yh(E(~43C.pL껾{AiؔF8? *=w@&@)a5+5LA*F aBAߟLp۽sofc຅ssV}^f^< PH3xH0aprbv >S9)Sdl.SSfd1$x KvzeN=Jֲx1 { m7eӁQ9۠Mt3A*mbxg!l aGl~2<pn~#ƞWhX {vm ݇ p6[q}*v}7cO :[{86> RkAV> YI~7;Ie}+i Tx%M-f3Lm䍓6{+Loc-o׎UƙyJzۛx~?7D S1P X`A4hHI]T)@,w[+}#hi 3FiU݇_| DQ@GQD͵$]zn~> ZT@8pI {x Nw&GShNd30$A^ŒЮ@7#鎱F$ Ufk(Ou8kՀr @Mx@2Pѷ!dr?=9kL3R%+[Ϳ A ziRpdP ޿h4|^D !8ߍJ-\}Mѷآu &,,q,%K L> >s6*o\?j~׶o =ZA lݽ&#G0&{Gei!̍vvfDꞬ \DBVɖK)-b,-;;^Ӷ^!/5 #VMB/d)Ћk#t@JӖ:c733;~s!CJ SǗQ jb٘O۲,20C`~$hAUNA KF/^\Eb,-?X蠗>&@4(,O:pQ4u,YcD6Rเd@tayK Ϗ aHWM-0|D^KOR@un}B@hHg'W-Nk`#{ b_0oG@r>{~a1ꂝ/|~uOّ8 xjU@qvm761-Dx2+&#𜔟/=GH7zUoT>,mEbhdv3-~!TWEx/N:kֱUtYLBJi xH3R\b8nZ>rWA @(MNoPqCGb A$[Ev4CVTخ< v]&M&\;OS凼iŚ~*i3Y$Kqfz7mZ6 ,yf@%6 l; 2 b~?K v&YM ڄ{zFym/&,= .EimS4Em3 ;A1ZP/O3#d]z`PpS@MٗQ-~aE@tDž_MрT1ٰEk}_&Ľ$h sF% ZHYڐr./Fdïxm{Jff@S{zh}\ը`v2r[,M2 z/px*lXπ'~Y"{@/+Li4tA8p!QuX1}EYE#R_2$ +-`<׮k;^{_mV7 Zzz-{HA Lk{"tѾ 6"#loњq=0 Xp,Q=ޮQ7iumiPT!j < 'hy*g%<_hD! Sx {iU *g/o{]-䚰ACD46 S?4y߳9.CQ+}d@dϩQ?FGX"(M=\jzuf9@V#;RS i?|6 R<Α` ^G}ur~ }̿l7P@Fb,RŴ/2jPfнJg IDAT޼}SFAk,Hڙm8 <80Hl=Z 'F~;CaAV:J] (ܷ)'Dd3(3%DZ-O`CjEЬ ssmTphLrҲ}7BܳDX, 5G΀ HA4…% K&; LF͂E>7ˢ @N)P|&.T3c|f4sf#,g{g ̨JSOIi緂{]Js(}w"p^^\G c 5$B_@4QOB e%ԅ'iC pH3W7ut];gHOcd ι*L3: ~c!j @s$" $$דG <ƗҶ;e|8^'̯z8]W/@ FI:lT} ;&ĩ+ d/F`>pB<,tN4BgNP:mPكͤӓAqzjJCpAM&j LO=Phi*1Dr \!F3ςtY (}-78Ki4p}ߛ)m76 @8t%AQ!-!~S EbGAE lm?0찰{HY\>LLp%V<[wҪwpؕdҞ9%wT@ Sv(`L KD0 b 1iLlp(&<`u:?!*/ceFG şG}Z~hXF} #֍<8Z3N"t.X"Όz+3R7A>N?F;)?D_(ni?"/Gnw|{( :1ٓy}]iQ}s\LZ:8t 0OGvbmIKj;իm`|3Hktᒁ#LLi,  mk]i_z89hyϏwγNr1afz#S5L77[4u*G,YDc 5n1O;"F1hDMsiGs?3r1?yG8\ vsF1@l9+FagZUqPLW71o-_ m@4֣s,:Lf84W?xAcFZH4dL=;ɟ;W ώXT5(Jف@_ (&MjlE-_7;Us}5 uy=A6? L39q r%A9$2OGG7|yWT?Gb'F((8nzN12Si⟅p*xL7g6 ( 2k9Z^M^O멂ڙe{Viش r7b˸ qB}mm:jծS.;WYSy?XJ7ݮnɒ=^ ǍlbLR#p Զ+wJ.'IIc L$L&H*Hlck2EgIM:Β5@Rı/8Z,i\6`ZE< b5ɦ H;'f"LO̹:3'=)*iQN#(X'AK:;禊s9M2hm#JY:/u~ĬyE-ӦHY-J "F7ЍιgvmF#5:ַV޳ۜ. !?{poY*sa{zPY&(&⩴<G@^51!*Kg2(+;;[ʞ;9QޅTHmDX;z4Q_cEA-e}ܼ s1ǽ04Cj5m1s[{FxoYFlj\0V55lI#]eg5"Oee%1G;cc*7g{ЂEIi/@M"_d"T ;A冦WVk[Lhah #Գ#Ű5h>nsbì%-]Ǔ&A *mG3i(5hL_Cd,ji#+~I(U%hV\ @B/뻦ndT~h [tȚ C28Z% +5l*7=L[C /|_Z߯5C '5s<.:ؠ} Z^ڑ2I0B3{jZ\jh7YtPZ^fs]"^a&fD2 m#JuBz +(@ @VRn3^94ZmnMz˞ ^zA%i(`2ZְŔխZ:H ZΘLׂ,ovaLFX3rYS:P#]EaMmA! 7u!3b.LpAG>PlAݤY',Cw?MpQ EWƷPLBA9[c[ΥO9n@>Yo|%p@CVQ.쫵澿1dUn@'cT46T+MAC a7_)P> ל9~UPYFlPVVh@Ertkj׺HZִ?vwA.zGo7iͻZ@ t_M(|eVif)1 biCk])8x +Ԯ,H.\|:Gd4L.p㕎iqiG߷TX_k׬w< M7 ~g?I5qxL#.I軛D* :]_} ?\]O˂LfIfȀzZ޼Cy#K% ZԳ+@[R˂:֑XG~E7k3/m{|l3J!t+Uy5?oXF@ECU4-3 &U&uax:Md͋%cأ?3T @ARU72cPΚ +d^3uMowDn@;Oab]p.}:bp. =t_Y/A\k,! ?W"Q5.İNQ셾j!╆y2v6cw궣:nAο8I0$Lָ2U;ّU ,dUԷ׌?o:|D$<-*r g; Kw;_t:Y~<({Tp4V7Dn^- +3Βų95F䂂\rԖ+|g#XEw!]$l",1(!oKoۿz*ÄZO]of!^EbqW WaPkF~hFX^c@<{wsQjysL׳Y5ly>xZǠy2]'EBttSt&t78HFArML(pv} ݧ:OWI+Ak$ I!]ց˃a7WRvV<^9@t>;~R=~fP\<=nRv fG`<den?o})!@8RAȽ l͂姠ƟA oMpHe1^3Ln)?q y 3i!c 6 !: Ɗ^(֭{i e0߰?HɊàR=(rxH0颢|O[dE-Jj!u.AXa!~uPDxV1%Uhܞ *3, }цرw#Z4f]JPӡ:6;JY2QY@Os竕K}޴c ZoK$zm{󂲳O)ݵtwyJdʤ fם"^3}''x&'nBV4BV6%E.icvʊC b&E_Au:SeMLjֶ7 dM{޶ 1u yI[d5mLAv{sיg~x0GUuo Bth\!.Q!xCT-c:~S6N,Ђ,w--@Ah6u%ZsSV)x=S:OYXݷ <>|tHP@9KUul1\0̍AfQ%-њw ;!Z^ EP:V6IA8/?kق+#]7{j՚vl2hiP* :^ו[8\9kn`f8p>`DyC8f$@~M0E7BqcRyKDkݣV~j: FPƢ GM2X9]]l4KkzǁunFg}Z.^;Oy}gmZɒ*nhͻЌFP_b#4k~š"zT0kstg?M!Z4s[1sz۾62ltlFZ}L-`HTJeeIͲC c 6\ &_Ot߽YU,YdI[*7T:^`,Ot&+euUv&x☀u코u*uo}y/2&BhU*)U0kB_w<Rq(fu_;^WZ@#f +Pܿ)޳7G?)<-SA ?V G#O|0ްeʌ=֚Ǭ#TY$dun/'@A8 G -X>d\ňRˆZQ ;ّuK cV{is[J !^S VihEH7t.ztߒ+aơoe6'$@PǠ2<4GT)ȩ¬R70_x<]zB7_ +&2/tIB tނI/3n:c.Y>ЦXS|9Po(oߺbzT<ϭsWBszW#+ M 43nA&Zv_0Yߟ@)lݔMI7i0U޺w'(W7VOƃ 8&Wk9-A;㚆HTAk#cƎjeUNMeM!yAJ` dCW ε }u@!KAky3C]W2A~ F{n\0vVV 6*Gf~К l05p>A3)|~(gUHJ``5(ǹa@A !'Rb>57&z*~Lk{M&|{7J]r/@42 7p,xrrsjnӦWctB]M@I烔0?÷;?cp0%(yk{sU׳ÐJH.)jA|k [F!Čּ+f{Q|<-$MnBؾeSU-sg CQskխiY㻙1:HIDAT !l@n@ a+ o>.=ws!;EraH @S%Y1s ;95n{2:A_ Mfm|%@~L7LZ~py=_ɯ~K@H!̄n|Ctth atF /'kc2Foӄ1uAa-|>t 6&nvž26< JGi澷UhPm@*E,TͬWUv0`-ix:D,uG'FgSA*̝p|$$uʑ~ 4z+7u>|IL ,[3N`_ZMW@BleʀSH:rzoG@8H7 UkL0=+>\DXIrUavIqMd2/u.! ^ tMtBXsv4hB3\ݾy*dmGedukV}KoBJ奊^<)i{~?8WU1ݐ3ܸR;2YT-@Zt26:(ST!b)SnK-j]1R:Av*7CiO;_ixy} s? }0P!ו=ws{ '[z`z(P@=~˨ UmP`k|l YkA"+IS.? (A03lHMiۧ0ANe2Ѧ@ R@7|^l}157'j J&kevtc iR2.RqIFGA%7\.>w Ts|< X Wd7yQtdh8"l4A5< gWaas*0Db(÷y}gy o޵-E@ gK3fD,o<_vdE>& |ΉV@G]'jSώR>}Ǚq9.·AAP,H\'pQԱX.BejXv Mz@̬L@8ySۋ(+tX*Y8>wq N? _An%T!}W_y}2O$֧("ܴ' NAjo(GyW쳿'?#޺0ºVld'=a"YV2 ε=oR3zI->#Y9xWepBN}&0ߤ}+ OY7@>[7˟ۧ^z-[I `1@t Ba@ Sm6O+T94NqB,Ts VcY->~c-k 5_(V bA1W`{/yN=.6BM1?ZkM rǎs[1wwpP9Ⱦ\3UUD<0_Hy^9O x A~s^MJ1gS?IK3Cm2*nзjlyqְu; w9 nbǎ~bJF4-U$Qn|~og>)&l٠t^OR{7ӷ;_n?;ybC0}F!,\Bhl 8 RȂHK2,]`g]D[\9Z𼬆hBNX*a1dNhEE^EWȊr!'x\9VC,y]C* vP?A%c-rhD1`4Zs= XL>yyM4@Vg( \>R :ߎfD֏r.:)Qq6%BbFUO3 7A nRn/Owd"_+ X ܘLBiuJ6ZYW悦Ӱijaq!cGwAbҝuZ'JQηR+$?-7xSvO2SnWS?'?Vs㫎QJ9*'6' lc-!@3h'/`~~ (w€{ ,#`A>Y\+rix*@qO9c+V)pblHЯo'A Lx7c>oJ7Eyﮃ73݂kY3Nvx E9O'+gW6 `|ˌrFW7gTA3͋TmЭ:فV[>,9 z"7ĵ S 7ο_A;`R2cDNe'yQفsqo%FXjH  ByZJ#pO_YeL[gh9g+(@)_!PN-- `[RV6ŬcޮW$I20@;pe\xS <<Ў ۜ=(0J /3%q3^}o/>-TS[޼ EH A@ c FR@Xiߡ\s? ?=ߟ+>v|M g~1^X0 (cV!fdE^_wr.,(6u‘Lo )VLcP#,批џ*>R Ssc[2*w%gzIENDB`( }̝аcOV"""""Xcp ""%0x0 2"&at"*YGSG{,6; `gppzc0|h??=}|~~~>?( @ĄŔ(I=mfy0~һ"""""&1K""""""""""""""""Qr"""""""'4'""""",pz7"""""+ f""""(%""""#2"""pp"""ѫ""` %"'0F8"-Pw"}v2"}F"Ȗ) =0 ')pF !p )? q @{'0 Bc6$Y:PuV&ZFotπ?(0`;ņy"_gv""""",zK"D""""","Kl,""""""""A""""""""""""-T"""""""""""33A """""""""""ӆk2""""""""",6AհG7_""""""""#d <l|""""""""ǐ3F<"""""""Űư6 o""""""<2""""""tq s` m""""""kO 3"""",Q  'r""""#P @:_""""#42"""/k|""#u@jp"(TBzRP"#u@5m c""Ðm"#m~",6RP",a5]`-kCp h{zL{yd$ _~Q %z ǰ 'RkLO |aǰ ߑr[CŰ: skEǐǡly l8G?l5@zE2y@cǫi@3Y_z JsjW#uUUsjF"",YfvA?|??????( ɚϱlض־Eպгط(aőpպ׺ͬDȠ̏ɉʛ%ʥMѲŏԸjƌdڹջѬIݶÚˣ".E 9+8888E9$TTTTTT@e5**-WTTTT@  :TTTLIeTTTFI!T.*2IT:RO3P/*:5hf:Y:Q*5N*F\_5: VZ&??=}|~~~>?( @6F;-8#R97Z{=Ƃɇba::ٴțu(&伄ěǍ%ջJÐ?d#ֹLҨ$լ̠ܵڿfڼkyI۸Ӵ[Ȇ4伆>mț֬+8_bԼ+$DžL@֦ͣPv۷|Z쿀w۽pѯܴ֫&Ҫ0ո!fAĐOԴ)ɑƞŔ**pˡ۸<-cDϝ*%Isn n"  "C=I %1+C Ъ++>C YzW~Xd>Cp7>b ip>pZ=n3pP>p>zpnnp"p%`_Q>2rCF$"$>pQ> >iQQnp>Cr QїЊp:Mpw>>p " 1=iʞ"Cкnyp>CCCn>ӴUnπ?(0` $$!-6a#4(j.;6ɇ2彃ˏh;)Ln-E'fٹҤ`X֦Դ~LsXwЙ>/F1E>]ѲrةZɏ'͚ҝʠKÇع۾GֵÅl̥*!&&#)8fɋ`0ƃ5C=S,ΦyƋ֬IܿfÇMȚԠС#d^ڱuҳ͟_k^]Y=@2?/ʛ:x,ݣIKvi|KD   fSI mDxہUA*T|IB|pkɜ\|mD\imkD1D+s].4}E|D }ؠDK;/\jj۠+< DۇD4{#&u|K/vzDA Q}&Dy Ekà|1;>4TAnKRM$ڮz܌j&HDm1nnf1#ΦƸ}.oӐoJ;01e0D7۠DKLӽ|Kh`|1$-|$qf%Dp۳qw|17gL*.m?I|b]|?m0Dh .|dUKz;D?$JT$ۡf|D.YM1K|DI۴͝7I1f1zxB$ L7;;|?|??????(  @̻F]-2ެd5̽Zݛ=ڝFʻEμ_-ҪrЛQ®SRҲϪv&β{&ױ|ɰw\e*̻_Уc͸iձ~:Ұ1 ܜC0/+ޱrəT7ǵLݜ?ʛXͽ\б~ޞDֵ5DznZ1{̸f;Cթl/ײ~ $ڬk=ҧhҭwîSͲxЫxĴM-ڥZεqѰ֣\#ǸIܵX]ڷ?( @ 4LJW@AVȆ4űQ۪e..ܫeȱQ!LE$n'(׺sٳ| '(ἆ۷ܸ0òO&س}ã`׸{@ݽuɴN$ͳO1ٸ|㻂&Ҹq&+nMռls>ݭi3ƲPѳz;;'Ϯ0 ݮk Q⺁G˕r9-›i% *1(D:;34ѽb޽y ݼwͼ]O ۨ_:բd+ѥfïpߩ\?.9̚Tïpި\9 9̛U̻_O5!*Фd35ӾbӸJݽv )̮Uz9;GŔrǮTJսi' Ա/ U}3ǴM=+gS>߮i5ܸھo (Ծf ƳNнD&ǩZ⿌z&˹H?&ڲyױy%e ţ`)ٯuͥ_"ۡN!!Qŗn>٢U%oƴM ɵLq(ڢT;5Q1[sr^3K7'¥^{S=>QzϽ_((0` %4ʞguWE@ALcȆдO ԽEp0IĔr$̥`D$o5 иJL%߷|$߷C϶L 1W#Ŗo;D &(( ἆ8>"PÏwϻF8;θlݛ<ໄ*L%,ڻvͻFޝAŖog\սk@"ݽuɴN9%ͳOƙlM-e%^-k+B)1-0мE༈~,ֽjݯnߴx n仁ռl/CпB(>$>7!=Ӻn+g&rh r߾vմ#ӳ?#2*0$ݮk׾h⽉}⺁ť^n5T(Y,*;eҳPɵM;1RP6 4)Ӹr(D˽Dễșl #F#گp0[Зp ͶLi&пBi;QLׯV(!IμEͼ]ƈ ĨZ8&]բd+2̻`Ųlɜiַ|(?ɺG5%űo®q^(׫m)οY: ­tïpƢa9ܦXֿd9"îsȵg̔s˷JL׺t /*ȵiŰQz ƫWCѰ%;ĭT3XӾb=n 8W6$6 ҽd>V3ğeŀG /ԿaA>˹HmΰS㻂ŔrǮT[ŧ\:'!:L A>ѴO"Z F#ԿBbǧ\ʞgޫc=,<>*ӹI ެdĕqˢcSʨ[+D [ ܸ,F ʭV:/0ʩZݫc޳v ̤` =˹H֮u#R(⿌zޞB˹Hѭy&@;຃=Ǧ]ڭm$>ͽDx!0۵ϽDߥSIAͥ_1 ۡNưR !ٳ~3d1 9]'YҴO%⽉}<.ÔrĤ_D#DкH -Ğfb/$ݯm6 ť^Q )?[nsrgN3!2v7  /ēsY0!AtͰS;њmwimDŽگV& Context1Script &PausedE&xit (Paused) AutoIt ErrorAutoIt has detected the stack has become corrupt. Stack corruption typically occurs when either the wrong calling convention is used or when the function is called with the wrong number of arguments. AutoIt supports the __stdcall (WINAPI) and __cdecl calling conventions. The __stdcall (WINAPI) convention is used by default but __cdecl can be used instead. See the DllCall() documentation for details on changing the calling convention."EndWith" missing "With".!Badly formatted "Func" statement."With" missing "EndWith".(Missing right bracket ')' in expression.Missing operator in expression."Unbalanced brackets in expression.Error in expression.Error parsing function call.0Incorrect number of parameters in function call.'"ReDim" used without an array variable.>Illegal text at the end of statement (one statement per line).1"If" statement has no matching "EndIf" statement.1"Else" statement with no matching "If" statement.2"EndIf" statement with no matching "If" statement.7Too many "Else" statements for matching "If" statement.3"While" statement has no matching "Wend" statement.4"Wend" statement with no matching "While" statement.%Variable used without being declared.XArray variable has incorrect number of subscripts or subscript dimension range exceeded.#Variable subscript badly formatted.*Subscript used on non-accessible variable.&Too many subscripts used for an array.0Missing subscript dimensions in "Dim" statement.NNo variable given for "Dim", "Local", "Global", "Struct" or "Const" statement.PA0Expected a "=" operator in assignment statement.*Invalid keyword at the start of this line.Array maximum size exceeded.+"Func" statement has no matching "EndFunc".Duplicate function name.Unknown function name.Unknown macro.*Unable to get a list of running processes.Invalid element in a DllStruct.*Unknown option or bad parameter specified.&Unable to load the internet libraries./"Struct" statement has no matching "EndStruct".HUnable to open file, the maximum number of open files has been exceeded.K"ContinueLoop" statement with no matching "While", "Do" or "For" statement.Invalid file filter given.*Expected a variable in user function call.1"Do" statement has no matching "Until" statement.2"Until" statement with no matching "Do" statement.#"For" statement is badly formatted.2"Next" statement with no matching "For" statement.N"ExitLoop/ContinueLoop" statements only valid from inside a For/Do/While loop.1"For" statement has no matching "Next" statement.@"Case" statement with no matching "Select"or "Switch" statement.:"EndSelect" statement with no matching "Select" statement.ORecursion level has been exceeded - AutoIt will quit to prevent stack overflow.&Cannot make existing variables static.4Cannot make static variables into regular variables.Badly formated Enum statement3This keyword cannot be used after a "Then" keyword.>"Select" statement is missing "EndSelect" or "Case" statement.+"If" statements must have a "Then" keyword. Badly formated Struct statement."Cannot assign values to constants..Cannot make existing variables into constants.9Only Object-type variables allowed in a "With" statement.v"long_ptr", "int_ptr" and "short_ptr" DllCall() types have been deprecated. Use "long*", "int*" and "short*" instead.-Object referenced outside a "With" statement.)Nested "With" statements are not allowed."Variable must be of type "Object".1The requested action with this object has failed.8Variable appears more than once in function declaration.2ReDim array can not be initialized in this manner.1An array variable can not be used in this manner.Can not redeclare a constant.5Can not redeclare a parameter inside a user function.HCan pass constants by reference only to parameters with "Const" keyword.*Can not initialize a variable with itself.$Incorrect way to use this parameter.:"EndSwitch" statement with no matching "Switch" statement.>"Switch" statement is missing "EndSwitch" or "Case" statement.H"ContinueCase" statement with no matching "Select"or "Switch" statement.Assert Failed!Obsolete function/parameter.4Invalid Exitcode (reserved for AutoIt internal use).+Variable cannot be accessed in this manner.Func reassign not allowed.*Func reassign on global level not allowed.PAUnable to parse line.Unable to open the script file.String missing closing quote.!Badly formated variable or macro.*Missing separator character after keyword.HKlJLS H}AU3!EA06Ms$[gZ")?mIgkpG HYd r%QMk%7nm'85 x2)>Uj$w1"Xq;Iƍﯘ5A=xE \r#nG=9[c'=>+aqmPX-'YeLgO i* ! =7sA7һWs22Qi}K-\^LxcѱŽJ"[Y"IB B>kYZUQ-Q81M;ijᩭ|l$8E]Rc'L>۞`xlVMxD*~eTʓ3s'Vi/}ׄm;]PbbrٮU鮳_Kc FB.Kp4PgiJMT@Rȏt[.dP`Ks:U$@,} +QX&25r}ȓdW]:) nmդ:}īK޹Yי 75UMC km̆!)ۃa?k}&t/ GgĿ=˰?[؄Jĝl~I<@ܡYuzdYkQpx%-1|T(vHAd5{5G*&9}߇eHjؐ7P^ gR~=Yюfd0~HEV]۷Rg+ϾQ*@l=yИbaԸt]ιFS_Ƣ#! *_ ;c< pT#:q拚W?I!W 5bz ?Sy̯TpW{l9njkk7u+ej59t|ͤNMjx,Hb_KaF-xB{S d?+}!#ޥ3Sƈ$O0)*߈Dw ~rWI~QDɂݙ mCUt2u|ɝhB4ۓ>ǤO?qkXnTY?oۻ ##%4hVO&FoC)T i0rx,}'JmWx;6*ׁâ˲%1.j)iݑ%b¥8bpB$g@E} @V| _VG#1v*ˆNizxcv;TR, (y^v}qOB=狷MR N{8CvEG.6^-X8Ga 0VTPCmryrXF  L'ؑ`NG(iwB1hdu: H瑧Z:T[R7DOj/g<;y#y`m ݭ`U'6ѧA˿h]oV(ѱc)@Rox2B „t1>>0|O⒌y* i ~aڹkHMY v0 3|u=.@]-{=nXXÔ\K#"].5iwW%(}ӥ HBӞ̱lanKLfv_z6a:0$1t)3Pv\<);83@ |3:ww^ )SF" 'T{`l`΍p&aNw1 Sv 09?<1VmFtER*!1_,8] :tY 7D:|pKpx\@[ Ŵ7iRؒPT.JFKB` Lm7OIKQy7x݉,Mxh>PkJiDF #K{QN,GF]h gaʃ#Rs/1g4?~o[_8ulSdRvH#\Esp,a=_Ԍ\@FGH?fW,9-;:?Ke.X*\;D+Luzӎ*@?↏[^w+L3x<$!-%T jp7窅?X~,Cr^Ee'7ZWw 1+X\p7?673ilSE@X&DU\j8 |G"fܑnįkiUZ;TӏͬMoKJYM@%Wm|i+nL(rV7zoE|](!6 7|R:۱cB!?@U'"0XYl{+_1${+:k^R:<ӭ"8{\J؟eϰĜ<tsn?JxMΧHaϦ~j2Ӻ pu²@Rs6>eO X3p3ۋ'0:ncT0jvhNwL_(b8o\|Τ>||)a~\9OBxd[GB)6 <%w|d+(& ҃yJZfVxn|jnώLߏ ӋTlf 0NtǜtE5D*7 JE[2a|`+/koYz67rO&WH"-첩lC:^Nb9K sN6}ϭ*U?=q+%T.7-lDT9ӄ-%x6GZc]T֙Bӛye=DeK`=XЩGIiE/zv9^+{uH$',Xrކ%@ ֧ϽJJɺB!bF;DaM^_+:*PU;Hx%;oge/{RXb=b F'r=3z*D˟ {0޴* eYړIM1U,4TyF<ä3X:r5*96ј;ZT,dI4c":<⇭bVK'=eb@  ͜. àZ<-h1 eDG7dJey pL % v LAYl?JJ98+_3 b%֝j%+!wWvn85nt2U;j+Gg%-@;t=]Q,GAO`uan$faWwʈ\uYӐN5녘4uuK+tRMMkP.u}RMHTLog0/()p [JÞ|Y|R&zU课B7Am}>l^ױbR@;"ّMaGʳ[bN+g% 9T=rOv-;*k$qD?!+$b xiN`E}oػǛQI=y5L_"웉k[)gU @P'BITId5^camۈ]Ni97gBsV}O"b+7z7}uZEqp0l.HVy=Ԑh3ˏm˒`ҡHHAP H,\!{;x!à߱d ',feAUhB/"Vy eh24Z ߧ *`:U7z&p8!F.jb]Uwu]\WzV|tnz T3v C+`@-i"B|O@-r/жJɉt |㙖i"/N'ᤦ9]/2Զ)LapKby&en{U17F\n_wbF!`ɻTy ydhӑז:Â;W! \VT@{d"$sUˌZt7A_3 j7=t-ejsbOB/~g,etQ?2^}Y*$дUk KPfh]1D^H R gأ<%/CJ)9RbAFO92 !ˇݷ Ĵl^[)1 UccΎYwBiI9Z'z"Cio.nJ}B/=*uFY0= '3vB.8V_9-@M3 =ZЭ]ʛj[3F{t_w~c[izA,r2hfߦhBwC-0]^;\JtS@50Uf HŃo@I?󝦹ׄ* ynR&w9&,G5rr'xU?@%g ЄI7IkTx;?,;;i|ߒE||gG<{bečKQ^_]H7: 0$E8o8&J_s )|9Aڂ/Qݩy \NIv9T;49ck*k^ P\41bXBCW{جC^j 5xsP3wJ-{˩Y <?E:b%P=l;Pn ^x .8B[^s\ɦ:wmhBཨG[G4"2> 敏4SՎSOZ*e+0 ht)b:>"|16JVirr]oEiw<5M51$+a$}QƲy7w;)u)^icȎ$ӮVhl@}Z,FTD8ۉ2%\JpIҧqvpqе Ʈ9UgF{6$d 3r)c"?cJ=%8xTd]$Y_lm 2q1j9 7!fT@{h !uС ";Q -9J1յ҂ SuPY3΅<:=?NXuաvdPI5΄<== XTHٰgQ ,{i[vJX,3BE2oC/G3 @VYUhcq:AVCg0OD&@9ޤ&/l H97RthGAc@I&(:x :wvNX.Y8ᒨ`Q`Ao,Ty _X],@s)s"V6E>Y|]l:5B«ȖDJ d "R}#-b!5D1KH9]3}ТߑTs5/ | eu[PrcX'Z?xGFj`fNFo۹ci^=UKe}iĭ #ǝ餲#f ֦v7Aاu, dpA}X5&S?eɕf>A^;]u<Xjf#/6f"v?h.2ks-Ç\Ma۠ -3+jea$L[^V[d`ܮ'+{;]>~u/fYz|U=jHG`טr6wwp5g*P:Zlj*V@/{25K6q:+.{*iL㞓-p f-G32[CEp&dHx,pW@( qӌh ƴs3N )HV #v?Musl8Wѩ t\SHuwe ^P=CkwEG Pvrn*x-5}qba:J}J%zvE E,^"ڵcJ7L 0clah٣63"|,p7vBF d;l"Xb;⫖$~(gW*a\5 >KCpZ!r:CUMaQl4clVN#[3^sRp>vd_ 72u*p?( <. ~Zc4 h`,xpA ٮ;yX?jyZR1/^]Ƹni[! GQ#~X43VSa_FO qȸy\(djHV8,p6"{AurWm)_Os$gGue7$ 9uT5]YVW$B6,LmR8y9Cg+H+JU^F*LBR/$ 3om5z :?9Z] 8ݛ&0[ !/~\9)a6PPXkӁ *ڱOT/AyytQkz(|+g. JHM:9"vK[?86C~ɰWjhKN[1wkk H5(d@¨ϔ!NO`M"I=aad J/Bϱ<$F\Ahjf]-h -_Y=!PkRRIIɽkH%ݭtU@,=~kob#uN30zELDw۟Gy-ʼՋl*}MeL0ơj[Jf. B)0akf1ߊ1nVL;?k6)|V/9VSBqj#eӳѧ퇑YqK< 6?1'p5L7?LUcD宂<&cJ"Q z'Fy!AZ_KCYA`쑣uv`5&%[F$o}& )r.A\aϠ}aNorw`FE {=VU{!QO/9aU 9B뙑] >ɸƠ$N0"+ pe$Q9<򡏳l w|{:BQfyfյc/ANG4.M =fhkQ)hfړOvƐ6Bbc®)}4C6 ksy#xRTJ91me@)TsC Vb_qLӹu`~{Do9l8o[w9үK*x$㥋E0Fqv`t~ʨl^w6 ȩHiZHْpPz0B[[IZw,l'[b'^zۤ~KXSF]T>݄V$oAke p —>aQ o  J`+htpn\--G>"J|ފH @|0W0UUպ].dURBw,.uid%;L\ L⯄YR|뇗 31U23tgmHzMh"mѫy$Uw:X3a`:m{ LMeto`\'㙽#N޶pW5:-RL427žd>Kw5x|xRB%]%#}\Y:,D3Hfh}F/ $љSMN6` TsiЈ*tAH BӐdxlkG_6p(}wvPlY>_A5,?)+xڙ[i?aqlяa1Hp]WHn'}s Nအ{rzT%kPڪbL{"! "R)Jp fy3̜9 1ָ_"{Fd1ʵcmm7ʛݩU rhO5]!DQ¯=2 5v'#r[NS8dD2 8a;RMm^:&#jHS?7i2Ttzj׾rpaWsI_'W"gG6QV k4f8T|܍Yz $\d@!^tQVt]Tג>d߅H VZRD,0{R- 9t66K-UG|J:#A^ kw 5әAcDxEʱZ"\^4D]L %a+ H,nrzpl [V{,8.M:D $B6 fpl~|=73M7˂иє1Z qMZ媂5dC*Kx"S;| Q ,r?|k 'vmV'FU]_V,1چ|7A5hC^ hl@ƉKS8MRL#6~TE>L(l]]B(T`YGU“L_l"&crP%2Pצ̳ݳu}OR ǹFQڜ#Gl11@NRd؝w`oȬ,HWiİXI6ە=0/aT/.FKnV) ^TP&n -o]/~qvnWJ6f=Č$8'߳Yy1kXbIMM+Q+:"%';O3816SI>^HKaZ$?28`~%;.]w ۬h(bw.)[ako;JFMGɹI='V?q19RZBdr6he^vafCI<+ λ O39G bgp=+ O"?w0=eNN <rKpN@1,Ԑ/VAKd ^sOZ҄UHПdM-HZ@/KSnc2q*Z>aq_-h ط2j"ܪQկS딤!SnjG3yg+>h=<٘;wF0e'Qy9'o9U<#vˬ(#Y&Y9i!v;FJ֜H\EbLFtY~u4~RON6ȻMZ Flƨ+R+zz݂?t6nWxiP/Iw8)iU^!~K,bD,aW1WM8pB͆#w8}S^KlO= }zCJ1 n\Еd<(J]% @,4]1GS&Ҫ4_WtQ[:yiYQ,O@/l[{І&} $J/Nr씠#يc0]?P'%ZտYy0X;ɺJ׶{JH}^W-[iab86 ;<$yN <3 Yԅ޸bŖ7j'Py:y#~OT 閼S$eq!_u :hn"6+"(3CWG-@Xm|x} YסLCwoZvê:' Bw *?}k?_#켍YSe& ށugIWJ$HEͅ_ٸ]0mKQҶST!mZ-BB޺r ! UX n\6IYLN\3-H<`2{{YQp:"TTO`uwK6d-dlq="kXv;e)fr8-Pe0}[r4F¦lE/6܂CJ1B)Je\Nw[,NMغk۬Ia;>R 8ݛS邹8ݖqT"7^*\9͹?HIʹ&Fsa%CrD9oP:i*w[C.KRi@6xVRvTjRv-Vq{Oo"@} 4*Z43 mq_s>`Ih<:U"{^]Z'I%@}Bj{@Py 55tAY z`֏bB71IW?#Z޾yΧܑm>=:/A^o }r])l!f9A ^6kaxG]&{0̻:S]vdtX,)j^9KlzVoUz5=W4rs5Y.-YFanbGgKY@,HH gJk[h2|q]cŸʮ4G% 3`9#2.-R$4 >'oR"hhz_0H'xͰiV0֪բ_qlngy fIUDMh[6UTC $el! ճ@u\4ys)7ݫ}3ٯ2C `rXw sl &;߃k1=fWpO+^Y >`V PT s~pDyF 7+(RF}9O|,i>MmK ]40"ry=ֿQ?{(*iIq^o9s Zsi$A, گ4}4[s/="^%\ as |SdE"J"kQďւRfU:J/Oo&L&B_HW&]\J2%dίGZqid9ԌMv; \wb49wPKxo0>y.8Yc@O>xjpd _f "\nߌ(O|^g[*К1>f#^Ro2Fw$װPNYuB]Pߓ\1'ݺ}:"dCh03>nջXl Mk.x>M˦V L}w!w0;.*q9rHG`+BЏ?y?U4!]5͗W2^& 9w-Jx- !>PM`+و5ES‰ x4@ U:Vb)s$w2}Џ+Jct%%jm,mt۩Ysyg Nd\[- \սԖV7) hhV9{wBDa~B5inGA[ěv([Em/1n$V,p6>ߞ<>zhjay::X:C\\hij{/1[; : z,-2Heb`kR}D[.%t~V,zk(I&Q' ;;lKwn "TV<'dOT[8qP\#ap{*UpG)ӏ>k{?@N5)^gC1Ml-x6̺\;ꨴVua͵&iT(#Er1qv1`: gGQNPa򹵐j9KKeE&YzhĕǦ^Ώf=:ٔBӨ/إK9%} ^{L' Дӏً1.l0iΞ|9(AOODo10u y}~n2g8 ^Zg.\ 5:M@O7tybDTibHIz ^J.JjAx%;кr[ȟrsfWȄ,I'-<j{:'B^ʝ&G/QK~m@awH5: J;e9+1ȍMc6,u%sUp.'n$RB?IA%!h= !ڶGV\ttܙXF_dBG85XƦ0߾6ݢհlLNMdi;]}j_%o1=bJ߉ > 4"1(Z78# 0l3OJ߁dzϹ"bWQVHP&C1g macOZ<)u"EcCgs2)ILw-pRvq>:`%,2kJ VB%u9J?8"JpQaR4}|7)O'wQ%ۉsVL VNd5Y E^*%ވ|PˋE(Q  `p3qAB0Eg^'GVjJ:̝Mܬ, cw ďZҚ{ ^ ?JF^~G:HމbxuVWUWվh 0<]z?梂#۷h&+j V'(Sbr>qEYCvc0A|,1ls{8>%A(-/pH|= `ڬ;w[~jeW%]h/`OSЕuuLūY{Kq {#'Jk`5Cy[> ]3%0T'0In&h[eA'u#/W[#8KԀ>YAc-L*}:?#Qt Bh֠{> b7H=>i&8 AL WNή{)g| Mp@zF(ē ivr.uI*-֯"zWO?t㞢~$Ҽ*nDd$D3"_8WT .Z/}sȴaU lky|`#IRlel#PSN\Ll S3H +IUZ= TY-0xSaWJB@򦦊O_"3o v,~1iO&.Sx2[%<=0j,:=  ji?Ε#Vnm܌`+9.-ǨK]olUPQdm0xZ咊itЩuq9ۥ䋦! NQ}{@淁Ty[3wsn~z_ аg838JaSz_ZF hT}JFz3|=n7Ӌ{1[7?v|i֜!=:&I֠>o*,u>f,r)n~Սc Ë5U*LQNos=¨A/oU r)ݩOWCԙG%m/57PUXa\dp$rɒSazƱ¬k=$מC'u5%9SVZL (f)C;FDrI ݲpr "X}U|ah'3>n @1~]f&7Xн)֓[i@TƑ7'aRAOP֋|cA*._lzRbRGz8^ Y#)SVFd%9"4% +=@R:u}0Cp&|[E|/D T!itZn%3m8o>r>d,S]lVz:7ۿ1\َH,Z/h: 璖ĺF;Y% G{@GÉ9b^v u]V1K&tUIZ ]Hb~ȹ4J25c]lXѱTbfD|8!!r?VNz9&F^?V<NPğBȻ4ci{w#CÖi=V-ҭYcZ\SzZR׊չVt`R݉&wQh>H^A :&qn<綿y+w 7ڶŤ cعMzϕ,Z]!ϭ~ oꋦ6&{}l?; ըsU| LIZoZ Vv`?f5. E2 ur2 j?qIuo[&wؔ3 N֮ɬWQҳCŅ͒em.|{t-K{s2iY^g szC!໗9ghSwncU5ܡKO/k ?CXIN" Nwm`Âk7PGY(F7xc B1SԔ٩Ӏ.8xӟ]Oy=Nmg"Bq{rTQpWhQn7Fm!?x-ΝߴTk^#;'N Sc@O_T+#o!1ԪI8F5sB YRR|p[1{svK"8#V1}k*~d2ա"zMҺ?]{V 3g-61Z.gIc㞬R?6ydV,wp~pÛd3HRM(kB#t- ,&$hg=1!XRAln4ݧeC Uˑc8? ֔>X[ux m{ڋ,6 x?z0x/̮ysEo#d5Pe⥱,%3w1r<=9o1 "˶po攥 ,6ɂr$ag1r{Sx{7|vyTwA#%)!tvvvAre$pPLFڪBw5uJBX4zѳ]+ $U%ЁJ|O@ V۵3 zO{f]( #IY~tZ=ŷũ3eypc\ ]oL>1窞}Y]9(^,7 u֒w{WM #\O8/A,;xqfލCC/[4[]g;a4Yp.?ˆ"j4R-` ,I1x!E -CRs;Sb}YEZ!/k 4B u:"9Ƿ F~jJFTz?$fRic`̙SNx 6/L oJ'„nqTcbEwqS+Uhc̮@^.iDIAJZ%< 檦wZ5a% OO8"?#IbQXBU2Y#m~t~̴2zR&+c=#!2F+ xA4dE`a^dR\JZFh?)ɉ.6WJzabMO̫}nE ?bJjh:r/k+}}$kǫnG"]Xg^;xVlC 2{$J&Ao- EĠZZl@9~Q\ \a|ks9NsL'8pǶ>{8 ,uNsʒ;&. yܺь/ IY&uӟ_@Ȕץ]';kCŝ:TXGQװ3$;4/! 5Wm idqzچ+TLUMlǎuˏ[)诩.«Lqvkq ҼcYx׿l;A\ңGZGue̝'/T~a2%EjּnIkK{.7ò z`J*z&%b g 1tvI疌L=֑BJa8;TNN_,E>şBNdv㚉kϟXD>^tpMa.V#9Z3`d4=W/˔]C= s9) µz)Me*SKU"8[v_'x\u3uAjq)Y l :7f(tm+SE~R8!ABF7~_ 3q 6<4CGV}l;G#q)M||AzxC9@HHY:.%m|R ZdДcڪEhS4wQ95c &f:„Uvÿ}TW`q.2=_fZlseZw[_np R?<әа<\ ,B("kN-ZBt>\61!%U٫KTfUQ 8#$ob]N[U'G9imB+57(?FZ==#OgT=cC0JKײ0 #u[NrQkȲ0/^)F/$߄OR^pxRPD6Aj"lA k+kFU_ppՉ 5Pj㛕֒2GFj(5i<-A癊g^= eWe*݈dĒA<~C!X(Iֹ V{THX5 ѣ-2ň ) Nvdhr&;J(Hv1`UNJk~N]:v/%BO Ѹ+ɏQϳR`,X1 UҭK?nlUNK^)8Y md$sO2S@B*ú2FzIY~̜WNDZ|K7+<<&$f&m~IXRCvyt7.F`6.sOX;u;RDWU[ 8]v:RFhH9AZvlkTo\RM抍AFf{/w+1 l}-Fxt 3-B?>ǂc(12 +۵ѱp'vk 9A/RƩ{ӂm!{iTJZ*+QZT iUN =bzPm1^ i$[wM0@ #( ;(˯ Z[hvFd3~@] !GVd/qbcP}t|Ԝ;~)qq.Ҁk,TvS\32:"NdKzu.RϪT Ri> r_R6F,!uЄ y 2}Q}m㔩S_[5ݫTĻm~a&0H%#'txz )P{NUT7 緉zf&,ApSQi߄d0k𤆕4`Q vceoIPrbAGpzpGa^ \`Zs^1!Bb޹ߞ_SM])s%hN)*"%HEBIq}\RxL$V?"8sIQFíN -%};Iٝvp0$tlliKkm'h8HHґ:e2 )n_~I_U&M*b*Cj7olF7>qk @ґ rb5ɴ]%om-EF$@塀o6i2 pSȡM lOM6! C.Gk70B&=H? K'ePU`gppmUHg,G.X|N9@?[<^RkhiT.LtQhaۏYfMF8eCZt EbJX}\FB4ZҠb~8Bq%ݱbC7Kl@bwf2;#N[u-u89_y08!'n KN^g4% (~:MX:ɾ75аD5weH|"|@TsxY:=8ܠHMg@-'R4-|b|GOq :Y`fF۞?5:"J>EgT 3K|I]be]jQnszxq,^u[^KRm %UT'JyZ<EQm3~-9|ǩ_> 5~#lȖ%JP6^%[ɓ{/%Z b*@AXaoO{ -57DWn"gQH4k~™RLo`(0sTe՟ w KĈyqbYt7r#3 (4M | (+u30o~bd:Qg4fv㏧qcd_DG~Vs ʖh_…Ȫ_j%TmgruGɯ?pd'9=%bcW 6P mhf,re-;W"_8csQ+%]tRgF[N|2kَIp3,xhxzpxt)Sn0%!μ w^|[fz{6ۈ^ [Vz˾N=XkrxT8+|BRb,CNϬ.Ue;2\b(TÏaQV/FRN+c(5Ps6dv,ݿp销fSSfc J?އwAٯ"QJ{rc'E֔azHG#"uQ$رAZnDe6y[Ap:N O7R~ܔ%p&3fBD:h`L+.?~F i"^~jt*1~aȯhs0ddϢO#{(CJy)N)IyFQQ(eAh@.W"rJc^gs|$hhP_o l},Dj;xb@*P !dG 3ױ] BWɍ _߯_zȁ?EJl֜&.%`5{S1LX^+U#,/.y(n4YZ=˝yoWPeߜ=;EY3g%i~fֱYWf}zt,DRUc~xb=WaYZ_*5~?%oD R 9Y K]ڊ_:tN1*ɇ%U"C^+1%Ea'XS .{k|V 0RI˸޻YRa Aޡ8VƵ;ž*\ň6H5 n:w±nvxΌ{bIi@nJOQ@,#n:hoFwZ*UʡYt^[߰ }ĔS`֤S¦ݞ)Vi# >ӷp!ɒ DV `gOA:0&jWD{i# F9+&s9h*g&#f:xᗋφ, J#7sD p3(^=!%{-)d߇E!=3љ+ua-*AV{fD[E= _9h6){#culѱ^m#lpt䓐cU-1/3)&8"͈Vn|;Y ioKjÚ \B:"=5Ea"BXbE5A cȶN!<AX(oKfSglMgxOzm Y6Y-2;xR*vO7tE8$ Sc5Nx9DJ`9I}ǐ7)u5d 9<3[Tgtd&(ȤLhjܟvD-QjA-ő^P1p~C٫6?rɂ@F`' QHȈ8^3 q,T9a߆xNP'? #t]TfUvm:bd}^U2=ءr{έgL BFiT!.w5zxۀlퟲym($ ʋ]{2M[x$HKG}YC̶4!P?e+* gqg=@3Q~{:fBfR%7Cr?iԫTNiMLW:#KX>Y뫍xo;cWm2PL5224W+?)eWR0sGh`P% ě=G%AtBE Ŀ,)lP\'{mҘ5t@/b {;)yq"a AcYt#H?y *^CW3"G4X<~Zަ$BS(F~ꮓO0e\S:aITX8!Ǖq~73SNl"/Mx@/5U#ޒJ.K1#E7{wT Gdwl|(ˌu'E\m]Hkk(G.a 9L~ʪ@+|9LXIz.ݖ>m(k@ VSDTPLĭK.6V" A]]Mmގ4T*95v&Gٗo0|)e;<^cX T"͋HD^u(P8|?r\\xvN 0p|@&e }D99]4qJ'<=D4,ecLn'4M*I.*+R|[KC_qFxq`H-3 K Q+#|_KP:߱{7@#%6dD?A#8抄M\#Rݤ]L[ %be; &$+i6aZ)>j ~td_w0[a5MԎiLsŘM 49^@GK'.J / M ccd$.%7+F :r$Mg,.XV<$///#I< {Y.oRȺf] sїEu{k>P\iԺX 5˨CATpGb!7g<'+ 3#tji5HFgPp4}ç/}X#N w,G5q@;囹xfc9й;&}b lGE ŝU@R62N3U,vSLZtٸ8l]`2zyt"[c_-v6R(X?g@e#s&6@2p2y'Hb ؃$ zt\RU x5ɆV)ʧg q51V8c|sOvq eɁoCp7y-HKm0ph_}b؇3xgmr6I6N k돏P' ӖGuSoSb9&Kz` "Jo1V[4IIaAMV?Eӹ[}qa>pⴑ=jв6rӹ&ӸcrPS`HAH^5 @`y^Ljdre p+(Ԙnr0YY\ HV Δ4ܥ˽td~lYg2BȈ!I/R #~lJ:om(;lU؞(9n9#njcj)+KB{P6-p1Ys|:S^Vx~R̝jQII{w%z)7+ XIf%,7a*$*TKg NDwm_Ţ,B)cV>z!JIC; SOgW%+>ÃdX^3SM)kBO+]gt=P q`"SM&Cv@bꎹ:fH9 =g!8$&G@$L\calȒdBOFe-D`vYC-Bz[O$ί>7PyS\?y0I_[cǕےT̕΂tu80lZTkSO-d \ {!Hs{RhH~-DW4@+7X{ ȸs|9fy%x>ȁACJ q$yy-(9|ۛfY'N{ICu\H[7/|fv0KGD[1HI-wc FOaΌҼo91'gA\Hm*V%d 459Ԯx<ݔg}8CŸ֡u9ͥgOBȥ{-zԡ%AZ,(!*_ L[Ӹo ؀7$\q*΀k\&*YVdњ'~&lLV ^W0OꊦoT܂ $)8Q}j\%R O& GdܗobU]jTh|lddYudpɔee;ħn B1 yEY<5LqzG&/lkZ {y9asl1@0#s:4D%>LdCY2WMIɏ:m Jc< L%njՄh':)lX4gV1"S'vJaWj}4Ǝ(|],_8f|GH˼a g,:ű0r1g"NqZC-ya#Tgm'Gg~piU䭣z^%毉jz'j;*/j$@5(c={fۢ1=4^splc6͞[u>*j8IسF[<GʛD2EȏT-Fi]upū]"TੈP .U9+wUKg8=?eMqyI2HRˁ,T3suxď"' _P\bFhKxXpjR5Qf E^Ñs7nzwDi{αzsfkLI|iia…&3%؝c:1*1_ȧrTbjw*G)VϹA*+U& ȦChB  ^t0"uTER~. 1bri`?;ǮpEW!"pG,'^17$P]$1>nѝ!7Sd69PPL"iB!:p^=>JZ;rQq%jY)u$);x5 e~P^^6GUۑ~%9zn=%( )Gh%"Vssw9(B:C7 x(hJXKHUaCRA!+?V;Z 2ʏ*S&ޟr(df5BQ{{˺xG=gF=B6vvW6*qLoֈ;ı^aã3v5 Bvb05g! 8ϝƝW \Dz5vl Bu)z:vmt ^},znWOMѴB):p&=76|b@Xu5pBK`D78o%~lvNQ>K4ʂD|I>{'6!-"J1ܝ2IU߁wʼn1U6s.H]׉kc-h(;5Չ9b' 7k>1K`&5HvϽ"9@cY!3!Lʧ3*6 nz=8.1EUS_E͢"nӾ^Y2b/~ֹ=z>+>I7q`P tͶz\ Z_1 ZFE켼߿}d9'@c=PP􊁸<θ$4}m9@:c+} u P}N&VMCR^@1 ՠnf%}لF/ kJD1uc1P錛l*)~b/VO\D\ëHc$)F`uo?sR2Mz ׼3Pt` FXKNb=6' T : R;-qjh4f{J!*&t Kt3;]O@UT%iFj4CO ʄ~9+\VuAQFa>bė ׊RLpR8$Abow p撚&ӣV]ъV FHC|W!e^qgs1RSǔ* YE3?I@_yTҿ;?ݔ"_wJb1n$1{swfO`+jT &}R21NqoWC`F"Q@n0wIT3DoFe (o_n,1%7C1qغ۞%Ml'Z`Bx^~y,K Ml$㋨,V7M1I6N,7)& ?wY}zݨ-:IDoguL bU;DS`' h gm|}5 H SPH@ =q27z0)UjS]Yu kk:.E螣4yCkm0@]^kf$~\u;JPש~yͦ(;BsC@8rRN Ξ~;@r/-ztK2#Tr?·,8AX]hʊ±ͣO5axPM}jNi\\'  {wjQ 5`'Ҝ\t\nj*e>/>|h?Fn08c~86P1D/E ? V˪&Z -{ 2&иQfJ`)c!\DW6og| uû SʽX hIkh˖Jw?g j~!fs~'$w}i܌ҼR,t1 VrT{K@ֆ 50&]]B F<iÜ^(6QMA: 8- c -G5:dWaQ@ 62cՂ'hknXkYf()C<ȃԡ:M6r{mLD@81TEGñczYjۡW8 D;`DuMrwua#zbfЄ/lݦr;>on71CA]ust]Ka1B_d dl ,ZDS&TӅ5S`mJ֧&džJחh7FD8 dRg92fvӭ~Ox:B7sL$.XK*nU_tQI%O-Y÷i~HbqӐݻ%|baIs)nGWBzfb}?d G3Hd+#b$@6幗1#9q>2 2[rkJBZ]EGzL3' qM̼bv(K*xlPgPjQbZ]~aB)Uɬ83"jw|F@( <~er[A.(,\L:@*R(94T}q᪷0*s"%ocM+3*2FWB:Ȓ 2Tz! qTDY-Nե6GS*Tvdy]޼s&\D3)ђS`,QZi223%Jt<#lV[;x̊:AN{=퓪}ӡF~'LЎD_Ȗf5N >ayNs،՞ӗ2AE.~ϲi| fϩ~6K^vCDo2`<DZw)n'z*zNP&YV& r2}ceˠ0x~p*kvhlpV_zS>"gŰ|fOu0\[H's @E/]T#`, 3iW$ۄU ! 4QxiRumKG>E9A୓+z:kǰBO4\AL`(n~>,U#Vkˮ?vDpzx /c5{v!F'fNiケo *x8[_DN|mcm@וW^A6hj@U>'[*EZx^QbD gFk2 Ecb4xtPG;{V3$΄l^,~' mܬiD0#\nxǼ<:t-~9ψwlD ktEoHT0+1a$eg={<}Ҧ|l]瀑N 2LWh$[>S)31Tlz]|j^Ʊ-A ax(ǬfeuE jSIVWyX#Z#Oclο~.8cG>HG5tn>#%Fat_^#I4MD.xϼ}dm[pk 5~8R ˺F?mݮ୕_Uw&ۡ3T *Ǘ6rkFBRN8ݼR5LDz} Xu#Aܖ8KP{5Bsf9 ɤ̾i'XY=g}U.8([%CbdM{C4#罰#c,Nv0K(#D|Ĭj;q^Ît❰\ `q`*i䂼Jv-/`BFmf @yc&RNPiufSϓrz6DZ`|C{L倶6Xgc],ttT1=H8.FV^_?^62ZOdY ^mDI`/;=落A9/뱶*ZBۼq>R_=]RSCe (UW44K;r&Iˊ);u0 qd; ^ ۤ3c]R*)bڑd>ӝĽK֏lcԑ- 0nĽ Zc9d'Hpk awbU? .F 䦹Hk6ҕP3Eg+.,ED694!78/Bٝ$A WY5 _aEq.oL ԕ{b ̺ݛ++F? RJѠ,Q;ѧˏ:ǰ-wb"re/XHAzނ8tmwϷ&x$Eզ(&3%\hsJӣ+\Sщ28n^eEcbݏXs5'[AuUby5XEB/V 9uOm!^V=6MuC1 }A7C@ x'KsQ;&PZ~d7,P[:"إ d7$S^9  ֟Rk,m"桹w 1܆ YЎâ4#]_["bCO#4os}5N*w+ڱMMtx?mMPRئ6/K?%n2W#$?Z2Yj!=H; G`WdR:[BQGNlP5e)Pu@Ehy5Yac`O.slosWqelՙN[oL l[- Y]o,=,*x TA*ТZFv8ܟy~g\unAr' LɁ8_Hp'2}ַ-jϤ%Pi&6!qWq/0'Y4\C$RW9^.N-,A0/]4nLj\tZ81jCGClEvl.Y1 7yGɲբvRб8Z8f\Xr7Cɲ+E\p$ѵo?~/9 u20?4 4۟l!$ɟ;hprOKU% heeQp㱫8\w>uE9k5_a|鵹7#o=.y%@ԁ=W_i"|558DI:'ZE u'%K$"vYZAܿ1Cț:Bln[([bcQH4g,^Qn4?˗͔[o[`u/ {-skv:\vNƾ\l̴x^&AfN4#נ y-ܥjA OM~ѯmE`=UȐHXkkD^EnnUE!̰e^Pۘ`U2є@Qy9 g8z3^U\mjUqM$-c~SDhfRbQ@ϖ.'Bx*3s<ꚧ-͸\ w]>;]5G+ȃ-%ssq]x¤ LѵWO!IըI^s*u-DOA4n^@7\^^ApicNfE(\ְ;d \eϋ셁)L)c ee:&PJ񇞕0[,UW[F>kXD6hk4#A.y^?Lc=2]Ue{#7&tQB'  30r[qZ_VH8e2~$l1j=*UIF4t@:@m4-^=_LH;Xr2;54s,?S!a ,h7w|g*IkSa[[\)8:^47"4'SjĶVt^*0Ù/+!3M! (Gs&qJ^bA/y&qri͢,AD4;v?5É pA;P+pIk lɐej/<"J[ụBR? wEYa 7PH蠔W`zpu:yJМ$kxx=xq ӚyyġRMu2bظsjw"s y̘J ̬߃c4K>RW+S1{'|\8ߓrx+=RCIw:][D8["G!)59KdmN2N+,40PX[w~DmX_꺙<[MH,'Bŝ0s|J G=sh?]P[^;'$#)5 1弡pu C4"/97٦[ypHm3t0=m?J1ZZZ`Ui^1KEg TZĴp.?U%*Ro5u77^!ky)?l^oF[,]z^kzQA6bd.,,<_ծU(l= t* !2)uhnB;ܷi,a . pJ_GU+Y}/;h687$U-vQcEd}y;]\EsV&0R49mGv||7bg6ޗ;_Mo]s rk$,د[.\)~S82sٸ;olбyΣ߆>|y#`I{ + zj6Cc ^fζ~useҟ)4[ : z9.XL@K[zs>农oSv} wvOOܿ#9VQ%^JVw8m~]g;w J:/UwsL_T_ QHP%O+_ѧ׿w\t Ghޝ zВQqCp2PbĚVggO/CJ#r/ 8ݣb.OD]r)^9*aҒ۞p]Kj䈨eu_$sl02uO 1>N")8[*yZ1$Ȉ]^f=$YOlM}9)chs D r+ԢunJ2 bkQy1D)zA~-+ )=eEф Dqb EV´vIΉl#rkv0^~=ӎFNwv@ Sd0R^u|1} tGBR yuymhȚךA=r2=:$TMGB}6.5n b?G]TB\/H`A1~ɂ`P-)A/c{m4+~ '8=ǷHJߌ=S@lG@KycnSeYbiڭ6gt)CVF{ D9?#x\l94 PMJ3OOuSsZu#"}ESIN=vr5uQĴTa -CߟPywN|J{4ڠrSCňI҇YFM(W- yTzU!,JomJ&ry',06W|ZO䰕yag2We|W[WyV5ݱ՜W>::kjm\l+1fKwBTt|p!1Q(>ƨ12ץ &M?Jl>3/CHG ʹ60*Y)1! 5_+_EiQNj?ǓC`m!:UF j IN>6[FȘRAS~~Z@̽lP?ǁ[*ǫ(YE=YPyi|:ODgzTCLk +,c۫unP]ULeTط[\D: .3J~n`d{$ ެN+ r =Ƌ;[@ f(ey0!n޹};n CpI܆d"[ q Srfcy>$ڦ#Q)'/qZs/5OmE73DEkt O+;ZKj투8’KpF&;{~xY(iZ8̴ *gI[ʉ6r[luqs;HF0 FfvߤŘt6;kt Ъ,eD(L׮f V``YO^diC+ Wx,i+ayzqmܔ ²Vqd}u5"t$wpvߝ__HBv U: #3ԡCP ᣕۣMIDGsm3C\D;S} EoBb]0fji1bCgLtqUZǴ6 mnw܇ E'wJ!0&ku-Vy#f3s⤩`#H>;m߹3odw a'gyOxS'x~ Qj!2 A#\NS][ z+UqғN]JbTJ }Yg']X=NQ4$4 _%"co_ἡp3,>|jANÏf7`İh?kacbJ6,ll{؎]S\g_vuN8rhvL!%s뉘e*8 nm52wNߋ>U"~U  o9w=,82mBցv*rB⫤Eh[Ӻ +T7I+> #}a 6Fx$L6-s0aN =_=g$o'NR#} n{</֏-hIzc`CL <߄MN<2!z h M`~ v=||^|pԡ yzMlgW8kwy$P$VJZ4㝣:YVA%oP\hD@ےȅ㴷EϷ^dߑMDT2|e!FxZXpuz],7wRñL IKA(Ս V#'Ǯ6ϛukT> fێe\&IB:Uvp0RezyiQ-NuTh-Q:Lev\S,^i?;}{)H4 i^4wSiŌ{7Zz)!r'W@8?]ASk =Mh]RH9t$NՐYXAt `s_3`nUR,<X`=gGmԴ !1JK3 *xL$y~__^UޘW/ߒ9dq{-iY]F OD!G&M:UtO^&z# k]JH8ZMilk8YVsk%TOe9PזtrBPwYS󍨶yn ,jM4^Y%Ν3dߕAShg?s% 8&xE%: 'Ao~Hn0҉)9yɬ Vkoˢ,I&'EFb.`;ʡ|QI@yo>c0- fi&N\\9ԜC[fDӞ%~ 'ckA7f72 _KOac5#eĐ͟yz tq3U[KQRq}g:@}>]˖Oƿiu[~5hQKhT =m*ՎNi6u5e` ir7 nvH/ >m0;IA=&$'֫]FK fn6&>MZK6Y sҙpKkT>;٧t̅JF,PgWfdJtaw9r/c 5}F1BzKH8!x fV+Pxyhngd@J<ul\DזDNTR9OcgDctzf,MF>rRx㝯eɐbL#5sZp𺐡ѽRV~1p GH ldjeվxBm5 B]G(a `mRv&z,NҐm yw?FSl^6H5 U᝶%[Dܣg:4:ލ O"Z?<|OWv,,p2{xi?Nt\&t5Nj֢o'e`2lp. yJ^߀҉dC;pja@ޓ lU1t}[o=˗J̞HX$H ȅ`^F׈ Y"CxG(Y4W (8ʈ+C)Rnga3_̹ٯn(lfaeuM7k&B>X.ExY8+HR":~Mܷ^DH@k!.9S [B.5s;L[ӕ[Nfx@ c!IrvM47Šk>ŪQ}v8PX5f|LsY e +ărԼMaǓլ*Aq$[)GSucfi5%0B͟kou0QZY_oU9jNVS[1^P$dY& Ͱ4 hQWIإG·I;}uv )>hÒg`G#08~:270"Lc VDNi+{H%hOt 3'HP-Jʉ\ .lj!V8۳(GRU-PBGfb`x3Gořܸ,_ p}~y/Y^$! ыrw ~]1O֌g~7%";k*,]}) r*ġA0zXnsNMTן)LWoEhՆ@ۧYuK^EA6|,D-)5 S7c&fC1U1ZOfdsTxPo4>ee0ja||~4ƥ{q6 _IH`{'eDz)Y&:1s)f$Nψ "F{"3ŕ/B溵1Α;D y6ޅGcX+ K+kө/p`abXTӆdJ_cf5$ 'Pcb_vNA*SN6 .@0;; l0P~Y)`> ~,v^uY^ЂM*-SQnW-/b[7@ ΨCֻd~25Qbg6#?/߁)Y'7ޑT<9@1!>cwzGƫ?p`nOuØ6suAȢ؛}]$ wsbo\_9|r\o~7O*A4W3r G ˽W\Q#?.nۚ4 $pp`s-T8@iik S"bݛvFSϵFN)/a.~Ѧ&$ٍ,!d=$ֳ8bx4} t_ֈP>TstUNeCr%~ȢY3FP$\ͤ%›D|uFy{,mϮMD?GdO6b \))ɀe"" cHrС)+ ~x#&ٚ?Zp{s! }A$Wd3z+aTnqcoj) `nvC9yőv+j~gJlǔMe2sG7n^m8nxUNhޱi0 Gbї5I|C p%J%~t^Ў>`5sD%Mӿoh0fĢ hikQ!w2VG(o)y'H;ǭ6&G|tOɂ2Sw7gQM[kVB$N?WP\kJ tϿ9jl Lz0{ڄq<0$5lH['AΧk~K.l#+۵UQ"o Ν*pJ/٨;ũq/=^_L0/>>im̮q6 £e0w&Rnbq͓a. z~ܝ6Y0QK8uq?,{j⯗+.=i3%j2[u(:cjCpNkdQ*.q#uyUJ|xT.]Q-PuӲF& !N Cc-XprNЧre k( YeB&CYXr%FRcEf Gɡd-VfבRI&"?R߰잢ȳ,VyS9|9`_e˄X ia?RZJʮ`}Z˩zY r#OLF)k.KB~MbZu&_K|ձ5aVҞФ'; t0Fh ۔׭KJ*[0QkEE [^ky1XgO1vH}l_} G)zš*R;c|L0P}Z.NYۈL UDѳ<HңocbL6: 3WʿmH>}Z}vܻ[Ճe}bad{* /_ 焛}Bk ,M4FdN|8 @gm_HKwopc$Z=Xr;*tDX55b"hIyqP#/Օ9B~fY>lb(PT54D@4jOzdG=4L&t%5Z8<14{|;N샸0W8N,>"l*W:ݳ 2X]LYЮ(0L Qh ) C!3m4Q&}GB˓UbQMs&HֻMziW*H6bo~Iah4,4x/Ƹc~z"يdM&>ƛZ|DZ'C◪FŌ1 TdIpzfr\߃@- 4 (;ُ,GȢ`r݈eȾcpz םcO]2 F>9_ѵHu\-% r.P)1 d.f6|јFQv t f@C?w7bf68Ҝv~ #oʈTD-.b5i׼j!ేD]7Q`0./9NKuQLAn֭fXܨr[JH+G\*2v,%j-ca%LOwО~41;p(rO4aH'Q30w99X#A `/PO Ʊ`>)nҦ֧C)NH} XĆ@>[!h8mgliֵ=ļ CxeKApS{M%ӵ{xEn1P20hV#j@ pzbDy zR:kq L32Ra2% x[GAZ} sܜTҚSZW(i4;ߡME5J V*$ U %\ҸnF@YͭȉIPq0LB?P`Z:xŢRC:8}KR-'"DPa_?wS܂H{uL'yS}fldnXߊ^fRk6ǘ3#l+->էE\%ӻ`| m+yRꨏdVߠSl‚PA]/IvPٳ}/J%NRk{ V΍ԡĽEI mAD s޻_b^pP$?/,f)r  g!$C`mlJuԐ聚f¥|cA ͱLo)K1={_`.2Gkφ#r06:ZD@Ql."Y ^T4IQG,X0\ĐңCl zXlx_D&.-I !^OSWp!ݔ'E0OEBx7[ 兟y0y:c)N0?r3ݸ(pOffAC[by 6gDllTd_OX je{ oN[B Рlʫ&/~̥QPcXm|hBZ9*~"#di"A6 KgZ]  9H"-h;'/a͆%%u8<`C"sTq}ވ fWW7KàaGYxYt 4'+ uȻb2oMP!7Iik:f/Qf9䰻.3)Jn=*_ɓ*T}GhjCWt<(B/vI2'p$DPZlۀ@ ɰu&jJa5hTCXu3K6<!S.E =ĉ!*r@8 Bdܢ:`6WV$Oxfy؉E=.TlT0{5D5p)QZ/߁̷}:`7:oE MCUD@6SDI897K^wfHGGR{ Vcu1S8MI(UygN.uV^ֿv.`j KY QJGh0P\}ux ; HWXqa/ܗW3Ǖ] 1\"K <#2 % Y%@\WYOm@)J,^Gֺj!ceS ,lȴ^Jxkܐf" ^nY3')hGMHig+VQjxBx<O{Bϟ$ #;ig|źhm?KW/Xv~ i0胷Lo;Znq᧗0^`wߔ[.k| Nūu2w;-T 6F"#]@aQl+,+R7F#J'"~n@C$eMnI#.vZLK{"B)|((0ȒgM˜9r,:}|GIjjqz=k\f8T?*P%}Z6l+E7s4(5ܠyb\-& js\WFI&w=zysw8@Z\.p8? ZܫW<̔VYu?8~N|(2;qΦ!pUjKɧY%Q\k 6>Fx4DƦxJej!pzMCMɓ[ԓʥS/0PĀta@R3}2p>7蘘 `LS(z{$`0S~Ip:ח4Ac\7,Y&pcE/ fjg"|tH1,LNzh]=*Um1^JSGo(t@)_N"ҷs~:PּXU <;ǣ`GV N ˮ@j Am.q9CbKY?BwO1}o'L: ̷p%4F!\fl1H25#`][Um}q8)]#le'MhaCF̋@(uV(Ruu@%9 _3>`i6*rT{o=CtgϮEql,jCtw[Jf\tOէ4DFN<:}g&vb)s=:mJ#K.I6S`L=@Әzt\t|e EI8XM"iiBcqhc>m0{-Pt ۋV~;ȧUݵq7Mf7X}ynf}0B8"ob 2pM#I1/6K0Aqh<av7zUiI2z>o7oMjq }J;r Ď\$H+X?ekaJN&>CT50Y}?t?ƬaOݩO\;SgC iesC~.Ybf꨿բ]ę ~;"!zIP!iW#.:NNzTH9F[t>_,f(Ң|k{_)x-MK QSԴG<[)ͧynE5"?<ܯv#0'[NK'ZVy!~q]IRƻjGާK0BqSDq~M}*8l3tށ /D# lM&~~!Zzeƍ\D+7k+m3pPX~M] w80XvڔyhFBe(b{5XoکMOc;sl]Dl:噝pNge [_ ngtι:ۉ&K9<|.帪ω t:o# #%s_#%@ے o'Kn/$?M$$QZ(IUjah?9w/M`lG A #}}?^RS:axJ|$rZk1Pb#n.f8&}Q`& JD ^ *%qVr;^MPQQљtIհƩ%lƑ|J»( {nymI?<4#fO"γhkY>%*#‘W64XvlXX&] \ڇ{iq+D{ (*~Whᶀ$TI-5l,;VYu;eJOgVf⋺ h#,Yw%f4k6Kxa'$C_jg iu %_]aO{anM֍֮L3i:b񃉦; G-YT:ee3 dجIV5E ׇRW]2YJa,DE3bJN,~UiD"~C.6g=x`z@.O뱔iBt`M !٫DmshhE|}Cr 072ge u-0@{Z<9f ݇[kCciWR$Kk\F]k& kVͺ \2A)BoꀀkҚkF.){BlS`5ciX g :@ ?ԭ€w,*6p}雁_.)HĘ)PG͵֔>QW~Qfhqek Ym6~qTӢ\(i)BME}SeuvvʏX5|O8K"h{(J@,B9x-fquI 3J[meo)SK%m֧˒85aѯ>6g_>.#I-ǽzϑƛrR8yɳ\\/H J4a_pUx{`8o/X?:^ /=k(pO7Kadn3EN9*>ɕإGv'!<גAɖX R2mǰu"|hDR8nc|?, T­ڗmDA%jKa?ěV߯^rTh -v^.E/ Xv,E0M ,@'؁q\ }[{Hb,dy;/|1KKl ӫLP%/Bw+G8J 1㪜"duPV83;]>tlM^Qr6W.1zZ+(SoQ쟈l9UqT{.ɕdFسtx:IsN~9vf wʇӹ[Ҳd:UFHxycdr6tC^A-n/aӼbըPhlxXau9ZIQ"S2/ιP^܅mI? ,YdzSrb[mť*y8@4C@h֮ `[7Gj ۹:qwNJ+68VRd~hTKl&hq8FrZC/~.pkVE\ÐWi[Go~̾+Ae87@Cq-"! EuT9Ya-ӂv5I# E9uiO`F}Ƅ6#'mUNz2peCD((UK<Gq#t;.L"FI߅ъ^ZI`xQ@ܥbA[Dx!r?hSƺP(cz~8q$YuCyH9șyk ;GPԗ*$keRvYN",oV۔`+qT8yr~M}}I"bl0Nl*:拆%dj㖴JKy)" kwpp5z?w'%GrG6O曁S< )-`MBlӵ{Q I* Mtn]!H2ayA3aK`:رT13<!#HfIdkwc[J ե0Q ?CMHMyǚ".(VwQZ)]vI:B`]= X'29~&Wihu\{h賥63 hbw/,e󇢕+?ǒNR;CJG¶l j>D<7}Ρ_:\a:bo8u VW`G6WEŏi v_}U*uZb7y5ʫ{_s4<|rBmCK轒$ "&Ía/KdmLlǷE =3֌6#IN?؇[P?1dPK."&4 ࣸ %$Ⱥ<@Nvw wFGmt\wkdA*wi>OZq7u4,r,7݀!6=ͫl8I7If&{Nm`zMх55j |ngr=g\]$.n"_6l 'Q j< j #zrɓm)cK4bg(z+Ԡefo=ڽǿ(JP}D"d-Ś[Vs@^qM 423דWì$7PރqZhgB|F9d1ր^xp:7~ȃqN8FuȜDLs2+oΜ ;J%0AEnjw C&XGpV.=0 w;IlRaPr`nOb2F Ki^MAH58ot4E׈du39>G^([r!  <)$ 8Įw$*sX5TZ۴-Id5B]+OX[dxP(r4u++-@AI*MMB[11 CY.[^5(i3ޯ#QwlԂB->v5N!Ǧ)jeSC1dGw~w "`sU kP_ cl+>a4ٴPp;~Ym9a%J3&JZJ]o.*F?SM %؍>01حd*Lc\\7zE#OQm֗:\m`^]`zj)FQ=p8EK]E3*|b6p,$t~RI%m5;~ʦ&Ew2Cao>b*+ Y4a y1@$\+Py,A2NYnC㿞kdCFsZʡzBCȯ_pucqCȿkԿ A.zn' ȳ;!'iD4-! N ],BZN$B6\g, ȧ=( mևQ`G2.xA~)!NPE\YBi^}H\Jpil@Oms[¹Wz ؅QՂ2>-]QOPB¶P \4>1qeCr|HDAA_,}G|5<'±R&(W/<ɭrCsat_h^O0?=xPGMVzaWMreրXL%x'?,ՅK2>8UTU+9F]L%[Ѭ\Y3swXP!E_*w?']s}R`#WzLg7]>5C_+1wl'iq`]b!R-KĊb~Usr(,14{-f;xw/oп~KWY{l'>h]IxϰNll~cD<5 <ڡ#cgvn6JV{WFtAmh4fXE[*&1lNhP}+\l1hRzx%*emHv?Mx ;@xG zs)q;z_) ɣ7_tҹ G_kBps?.Z'C1DPQ#m|q7SbJvr~ο5!}r/<,EA^xIq= Zm&PauTXz+*u E 6%mYRy%|Kh54ƙ#bU+]"~(y2iMU,Q"Mq&O D&bU*(t/Ii Ȍg 'eF#קXRR"<Ū?I($hgZ& g_!'wWmoIGufXuLVK. Hj+.LR6%J*荚d 'RӼ0kD`/iLϏ"9ul1y-$>6) <BՖ|cv,%fl_TĂطS6NZ]_x`q+Zɠ QBv0˫s<'’rB-eTD5@pL'kPL3F·1$`9ɣ 9e\N*2<>Rz:; sq>\y@9G< &#n}ؐ֙bxl1=W.WQZs&CGp4!EM&XY}"ڶa5|@l+S'bzԺi~9u$1d`6SFY04vy,tg,5Dp}M%jñIh0Ӫ4>sӝ=zE!D ҄vCjuψrq>15ȕ 2G +V,oM0{fc"[xӛ̹(#?n]tk O Ux3u&]}Ʃ+' mk"\tiJբF KzWrv#k7A!9t{GlUvs3OW;0#2oi{>PG*Cz wz&B9RUM)?{ s0+pZ`M"y<ޠsci,tG%)6q.DZ<™)ҩүjkM prٮƒQ+ҖA%+Lь1яEcj3_=0`%z޾&X<+x #!LOXbN% &!7Y75jX)q0#HY nmHoR&ܥaX߹\ hmD[KSP(HdC4u)nMLUj·KMs-O\Di>R-;yڒlۉneέah+B1D_!M%;MgѤqu.Yl(9lAc]fq ]qoS*3,+|6杉/Rƛ{2c9 q* )-0%%>[Df_Ev2i?SV!6ۈ rkxV$vAz$q2Jؤ1~CEԔi{ chQzɷ"PՒ،ΘELi"m IE@Dz<cMVXCz.4f8=HzܑggT6'>SﲭVwq[Fq<ExZ^R3gQHn4f;o#[H?~y MTz@Pp/!(%rWbH":}'. [y [0(S_!oZ#}7'H-%wIw->C+}!̬m/R̈́Əw2dWMjRK0{Nק_,% \F]n_jZ3D3K7 ەWT ]w*eTfM+4<{NF}KmiG^5*VdJi@l;<^ĈoZ.,+1ϘZ;?coS]PG>އ  MhzfiF$w(0u1 ;LCk6]2M{K-nNI=QqP"..H,I:I 09eeRK򠾞GqƛC? 9 pe$vڿ>-*2djZ4NO{_5Lm~naF>juM!1\<5%9<WR.hY1B`4l5<ƹXTS.ho{67r{a:y\S~^RBEmRkȜ2#9ZRʦz؀{uu·^͉>ɥNia@BW;֓ߝF`զ:SH<:SZ%(Z."8(|*ߏJF M%|+S?`ٽ"U;zt [plt##pBk 2ʏ |]}LéV֠ kJ&̙b+BE$(&jᕝ RKU^~ ƑzmC-tjX5D:'E5K`*Mk&df_[k#FÐlճHo_8, wbg2ccx^`X7ٚu܋˭~4ꘑ"J-bӁ E~ĥOԦ܊9ԞN8`hX`8aջe!ݢS̕Z #1wZA+?sDg(E0065KzI>I puaC4 ˖۝`D5 hIPsЇHKu~tM.bC8u,c0P8:8~KN<$Eb9. 0f :d/gsofX+6$P5"2ܹ%=e5R&껐٩QH+Cae^X)uٞBݻxRPB?ݺugHb\_ r&; N/:GU}Gs;r- 8Ikad_ƿIh@HpחQtDJt+4czNPu&JdaYT&݊0@;S3 [JϸS߇/4Q%{t.IFydʦvc6f:dQ\5YM|9u_ b1' 9YJ\)Hg0s](KM x~8vCD*$stQ 5M W"ǶSC1l|ޖjNe6j_Y뮢:NLW];^Jay2&@|?RRCrP#ziedO%65phq5%]󿇭w7yD0OZZ+,bjl`8 0 0l i-Y$B1^ :S&΋&LWEp6Lt!X!/ 㭅;AE(YKC)YZ)a۵*K?Y͓}nΒ~/%DFa4spVͳ9E[P?:;%* :,3g]0hC|>8=lllFB9u^f.'I@e]_V*UGj dT,h(0s䷁_; =B؀za__l\T%j'ՉIDċM}*}IKz'3]1RpBH}x `6 )Y穭HTE#>TkF(JSJ(o5e?ϭFqezF|$5khz˓m ,LX<٪%.7Õys=nj Z Srk/Bͨ5t/Mv"U/f H,~Xp°lu:N o1ioz~.)~FT5'^m Gnpy][ّ WEtW)F;l-NJN5 EcyFfX^qC ωZͺQ$H{a@~L'w/wkz)H&k">nK˔*“P1TT bHrTǬP = o\(mpRHha'.*i ^eiCzÝ&-'i& cn S %9_,|0 ￧T1 DҝPZ#q #E_5&#Zy5˹| U-\hVX*R?nsƧ'*dLN"rA];8qdI/EQTOwRᥐ$NvmS_o+djР(&Çdߛ,x.@r_xm֧qg}<^PIrVYn"5T29lms;j؊}գ*׸WpfJm?TQIwkW߮GȺy<ې )1kGj(1Eui,.WT%J ND@P6! w' ;C>3U(ݧOn"`;X$6glw|gT+zAE`gF邀-MTP_/ǽ.pyo Ґ'AG|0'j[+ rS8X`/|eȥ |i[?nLӗﰧrj]C""t|KX_i\:<3ݧ=aФ_-О?8ʚ"w"'dWlJXf8˝}x/U:63d{P7J GO 03+V4nYT{&Bt !L l6DIFŎUڠX#~XHw%sA1R¥b zlR%^j]ber `vQj*9<;8I1ݠJE(hsɡ3O]!]6!!K Vz(2;`뭬ŨOl~u{53m+6P#4NL1r_'XBJ4`h(ב88Ylx/K q+lnΔ~c! #BAQK% pz;f0NJ~NSs=gly,Mj9`;`VI@μY߹Lm#zRcϔ+牰@z؁$0i0*ʳ+ݠRN> /<︊/mQ*&4;s[RΫdޔ< |;3#IțbO$$N>&(:Jz[B`4I2ұ!Co[zw愈މwi9} CB b2\/QK]Tu'g5WR/d?T3L jF1m2.>҂2NFٔ12ÁԳ8{B2*wZ 2/I,r`"u8&ܿH% GP "`Qˉ9@Fz̋Q\8.Ĕ6CA8;dDBDB=l4 sf8_Jܚ˘!4.KԞF28О'?je7hoi*~<5Rև0g,;wWt'͏i%DD'C)$+*T#:-,5(vL6E a&Ԛ!"~\A~_g_Q ^_E Hcr4Y~d[T=%rmŽ1)VWDn!BM?7bt1W"enL7ẳԋLU41Kk-4BdӅ 89p3٠J MOۍAV.yrEc^w9%1U|N-m29q4v՘9'P5 פH&|TG"+ 佱b{>3n9-_ȧcB|OБ|!%5y-lƗwr->}ﰻ i=(g9T*Ւ1?SxXHa2u",g+^>\(Z` /xZ jl)b I2$d앣nL(L BS!3;Z|?}bFZII"/Gw?>T,!E6Z}0 eF&:ԣ,ȽTHY8(Wy˦ūoPtw["+ _ r/PwٱO@faB\378u?KW%R$*R bפa $o $Ag|OFIUceY_uIcsY/PS5bb?p'“f[6?\ZS/y*xq`24R,"jp7]f19%R{' jϮb8Q&(IBX=!>Bô1,(bڷ<목hVٵr*֗9ia%Qzg"Rù L|ذi\|8mJV6.:M5nfڵ<TH,ㆁ6f L)0mR5lߡ>)uls<6PiB./e נ` |8:-[-Y g+&_VhNm ~֔, ?|=:}'ŀTFGCzRH!7sg y20"js$ D= ז-+x0 4~Or vvL'7aڀ~Yi:,>3ϸ^(E~Y+/_iH3LԟEb|v[g&x4i%X.`Df }Yg8oUf/F ?-uigc4+ܔ?v'-1o[*E*$fA8˺~캰64ȶҾzNu2j/,Aw 5$ |>0&_nwlC.jC&ざ=ʡbR+.0xYq;Y3 P>A-Ɛ7ڑetJPI tYdg:n_>boSW~&<쩗ƫgtbz?*`yCqFػ Z1mb|cxsNIe\VJRB-~opbpv+>nXpE$38 +E5`sqopAlvzO5DoPruV5Rq<Uap-8C*$O4W]. uI8=NNZ5nDڱxB><( FȺ dFEJp@wTy' ~2ǜDĵ}&pz]w7(Ⱥ~) \zyƥb's)裖hsO]u ڰuq o}Pڅu=Ó][Ӊr0ձ!S"%-Ir1ϑdO0˔9ܧ>oVQoP k0b lI9\{ὕm.pZf_L>Uܓbj_x*+3zWW&h[ x>{ziqZxpWM`Hiɬ,} SBFQ+ܡy؛g K/A| X{9:d & @R&9%٧7uFc+ MH@eX[N'O|)ka:U]/EAdtl?'Ֆ't_ 6R[N3*!e_WHO/Dˆ;A->k(-Y9͋3g}&$z([$lv+ˡ- #K{;yM67ĵ1M .'[?tAK(p~kL$Db5ssE ##xT\7L?'Ln3K&\ԙ"ULVmv;|ҿj[YA*yeﯱ571H-~x-zi~I+!o[3守r_cBdQY=(ne*++%|P17[ͼ$?0ŗv#uQg'7}fA9o8{vFJUu@y ZLރjHœy'T#jY B*Nȭu(71I` ! xQ"!s5ؕ-M$-O'E2/F^ۘ};2MqlIz1Tq6 ΪabQMIp=ua#OHR8z%J(j0_Qt߼-=7afZ+)p\B(7R!*FLa!|{%GËčJ =Ku>NA~@i)d1 :hQ~wSú,{oTfetUi엵ZtK(X. Gd)QlRh#SVE$2(8V{.iLREp&B:["cן=0+04?z{7j0~O%O#f: MtlJ)5Fr5-x4 ,EަA>“_c~1LuU+OM!HzS'n\QTq&#m"&B/mFd&Q\]Pݤѡ=# qO&3.Y0DNG\iXPR %ɏ F>ofbݼ+QzdJ$ߞ{"6U^8T=!$g/+K6ܜd?(Q`zwp0|˅2<7#-K_f s۪L K]$nȻGqYWw^bÏ?+O74*Ya 끰C[@4G&Iv+wǚgײNAc3oP%Ve.`͔+N-L<؉weݖ;jfSaN}Oqc;`kv@ԍLuwם)Q|sskVt:*|KF)>EzR;~|l/Q6?jW[׿DMp%h#D;+ ND2azG}CI o SbSg#˷?( #az]#6h'$5:%h/CX=bWr]eݽHv:VQkZjpu7ɲYpSy:Xsq-k7W%1/$-)d7k`!PSEp #qAyXm$< a&5؇F e M>azELDyQ,[>i+X>k-IZ0g?˚Z.ݐ?V&21Eh\J ~\ bgb K6~B!91b'viom<-;ըN*=qؽ+.llӑ>y=Hbta%6ٶ% 2 :<&*Fg*c=:Nx=cw^5o`nH/ {-۝ 0Z֏,I$r-NSh+FsJ"Cu՝~ۉ?'Nk9]:>46D&Fv!S9ttn|c% MZM2ak\Y'Zt}ۖqLz=~˪P١/;Vjl"@b&yR`Q)N+ja v)v1bu:'AńmaZ9R:\@Q/2@a甐Krw6c$[`CWiXk몍SS@FmQ{_DRqMɁ~!QHgrs5尧^o'eimCx+E@_$%ׇ(sMf2نuUijrc#˔ĝH) N X2&]`Q'$f#gRK@o8K/gޛ[}D)OZ0x/i/Zt/n ߒ̄c\Cf)nгO0B8 98 ֪+YrUgJ늻2XWO pCS}xd~n1p'€N)'cUX -WY gx&i-)5MtBю{g>uJIYgXQ%۾*:$,YnyKU'M[ ZO2uO6j:!-l&s-DŬDmVE2$#1 {p`OdڶLq^Ae+hOk|Mcun)S-z_'OLR.|`k.F?K/_~?/xӳaemMRwZAY y ~L@U&kaCF^B\ߧpfzk8xD??(lg6y 9 jh@*oReVTwV42ґ/Z^2 LMBqiWXqҟC^&eѴ)v>J@/ ltAZvpϿ1^_A J=g3DCpP\@VgĕX}^ZqaO_H- b"޺R5!n{ YNv;5`i2:L[A+8\y?A bT;%5UKuG*ÑzAt^*D+ln!Hot>gW5 0¨1a)?ב1(6Jdd;Q4Ewbwfxw a0xt'Ao|,u*vW/tSԇ déi ~<Rw]`@JZb9v|+“ҶjGqՁ_,iN.L$7 {Q,c>Av@A̲fmKy7NfhZHg3EWyؔ9~oNZUJmrΊ"_Om>}x8P]D3-P0`0VyC av Ġ-:ڨ3~R:XqnlးD? Fa[_Đ@p -+=a]F<^mZ&ʼ~ eگAN5ܣ9j4{~s320JLNbg9iO}m0.lu8vD[ pa͟|w 7tR9_vC6[C\"+5PJ쓑˳cPgSVbwZ.-6}"__'\F| ߞ:P:cB y/n.m6ޒ,q]Y&\[F+MBXl#g."R.sAxv v-unsӑ5H1 ,&>),3>; ;{7/c"FޟeCZP!$Bc027VB. Iwঝ׏PO]S Nxd'̇׽$f&?8Y42/h[vFk'$ֆeDnĦT9Is}(:GymջX鵦d_Mk@FN۽r3g';9 ,XoH[޿ҷHUels6V $=>e2Tq]GQWӍ`$%Uw$n۽Iyh3.zY~7{@7e^k9ÑTFt@;sec*}?ƽ*;mޢآ7_$G*;6U7g!ozW+H3;RdG͔YuuGӈڑ;:e?nz5Y0*H;z'3B#bغUe Vf"J4 ]X[HQ]cVRE= X: ofe`9qs|p1mT`A4 ,̱ )N _o)'Vl-h͍k`Q-~z띣rcXjqy 6H%*tj-Lnu $)>C4Q;;YJЮ"G}Z<}.޽4FnK6Lrzh2ꋒ5S$S4Wmʗ%!#H;(lw=Cso蹺uEi,dccCZZ2, \ÓI&GLNZX*v i,Gt=eF93+lwuOjKقOR^?":{b&@ O9UT$ѤLxژFT\<5eݍ!+q.I3>h5"KxbMk49g@usq ܰЛrOŎ$7.k7m连>BK+MeNb7ĢVA|hb>2-O2d Lej)?mˍġ#KL/}8jۆJ̍è%=PЎʍh;fvY]}]$Z+x 6|i/yc]o)Ǚ ZA8&%fWWZcREMl=!l]A۲kҴoe 'Ŝ^ !_ڔY_ 5àHř|˨Z!Qh8T뒴etQV>ה"gi.⧱S}c }T1cA ,<Ɔj*%^Cǝ2o!N>*Mg?]k?!Vg{,G2,9Ě=kJf1 aןU9 / yNX\yoY R0ݷRC&v1ʃz;۵qmC:3ª2쬾O&zwXl'Al¥)P$DJ9Ӕܺfa @b|.F>qmW5n?YzH%Kבғxin@2s4fVw rE!l3JӇW4a0}[?0pc x 8z>,JK y4A *Бa:5>x{I'?<W(jQv1px}u1)8@=7؍q\wZoEѕ #:uK*/s#ei(7ZcI6gͳ5fA!lD%Ƹ7#/6f4?H!SKa?{n:/V^e5+Fc)qp< 0b;INԤ!#tx;AE71"~!i=[gpdC2g-o'A.i'ǘ ?b%a$f2or [O䬩AFTrD du@tgIڄҏ*ŌuyI.Jt]`]>%9`HShDD/$e;w,)SlziTԕ')h&[IYfA fE'ePVI >{/ߍAkLabi2#?qf4\Y:HqQdw{{{IW{ɞ!ZZRbp$A%} cV^_&o3YoU}n:g T B $vmxqߔ הؖ0|3㽪FSٕ}([ mKS('sT,z/5$\9RX6w_.Kۄ u-w +߷v0o6k,jt)5RbXQzsdϭǎ:';hcGˆ=e}L)@VE>-'}+ &LbHk[8}k>[fHq%dcե_-Z[[vW8IJsp.Z樌bu"HI D?5;y\MGG+]ݓ⹅eaL,0i QwWCU'h`y/f`I/Wɋ06N⧖svYh*=^pqlG} qAwaG\jvҗz_2hFui*|(򯯹+!"=}K Ta(pwMCW*[D'KWIec'&QviM؛k`kJ9GQ2x/l -~؋ñ9gFۈYC*=@J 6D|lCF-GTW&K;甔]1I =rXX_ 졣߶*x:*C rCeԾWo@)Xը9B j`l˪Y ~Q'%#F\AWߜ9;oR*A)EL*ݫ%@HQ"Qx@c."ρ9Enrij9C [~ X{Xފ@$2ߎ9}W}ՔH^$!oiHgR񩋁зpfQn2~DF4F8Kf'\B,*wܥ> !$PnKF+hC5rNG;M!@2.Nou Jc SWcm}N iͽ&F 쪱#`4:tnk`v`Orr$QQ.)jIIUUJh:MLrB$JȭJЖbsͬXt>zbKV޾cr,pm  =F$؏j'+jdIaGkV ( FN"Ni}v %^(%e0aN!#}ۢ&_XQ@7Yxup=m<ҩ䟊@UbmNveHTPCc>YXI?b]>N&F%}D'ѿQ& OsߔoS+K\sJ,AI-k7olEΑ0wdd-][06#5V_^<O}H, Ϯ:{þ9H9E[/ gx]8]x 6%΃v8y@94jrwK5|q Q(>U!MS͚̽շ|ЭajZXw[bޯ-fA9w[%'h4Z䛎2=K ^xtˡ{`?(YP7󝎁"-E$O.]ļCBȞeY m3eVi[mEG2["aDn?qa( w{/Yq{s7:b;! Ș8zwt(ÖGBxHqkL/WgrS´q wGI>#tķ8:"ubfw0,wbp8Yfyy] 6/͢Hq0f 83 (^&)?oOCu"܀9icg(ک`%ugKoV3f~wm|t*]2$x2w*ˇ B,}7 ӓNf23V݁+C6rGzM+_SS%~̳OVn- ϽqmKOi@Q g5xכڏwn㓇4cLSZudC#0 ?dOSGKT*"b̃e5,+Fzۂ?6Gd< l#vF4*6<;VEd?2yƉLe_JY,,R-ڎ1UQ 02;Q)`*pa7s7Ð-A>0:$ Xc{ |am0ـ¥HЅ<4 QH:>i7H"n4k&w plHl}~S fΧ)Q+(8P;K`6K27z~+!XTJ\fD޸`ʗd"%v P܌/5sayיJ7[5/AfVĒ@`3\-rHIZ)=gwcWGA;1ָH+svjHd%I a Frމ9"ڊCʭR[e$ןhG7΢e)E%0Pt䛯- m?mIwB3$`gƋ$h78RהpyȱM3da lƺc4-ۑm^ǹ}xvJF& HXpsfKU0.n _aQ55t@6zY>4ҭX v$kQjAN NHOM^#|hAP( 2 VaCJ@I 7Y DY_'em5mfuYg2 Ι<_js3݊cΥ-_t}_ؓ [¶dɧxBljY˻WVoRi_f*0Yњkvw3j=H,l`fd0\8=ĺNuE_s<"_Oz\$ wDno$ !0ldx*tU5KB*2w40my@Ɩ\Q;_b)̰%#iq'q[9~M<{Cqt٤pF>$\Dͼm{bUzkbA%@tBbOؗFBQj[^ߔS=RĶcn&өذr%SNL2!4.(Rx)ESKĐ_D{Ur[DR!^8jhы^^}c@_%fkH07TRuًm * ۧy ^8۾J0al榤uVnp FAACv뇯Ah;H}4Kc"mڴˬz"7FtC8)G(~AY` Q˺CQ>9(l{T-JQݲnuWYK2!H@&b2 lDVl8H+H!$ř.۹Źdcgm?;}:ވ\_|QP!8PVb5pП|,t.\RTMF}QOw,20{_S$M_'h:b]1 ɝLEoȟj:%]D׹_#>6.ZB'P l Y*/x\:X8J`ر&M:u5- gTYmH_aY$b[= 4TRLk}[MgŭïD=" }$x- b g FUL+\™oA=`t"e^G^^ɤ%ߋA1UDd5_jidAU@L~ğaP[Ӫ#0[ׁW|ɸt h~L1E?΍TSq`?&Հj:$MzzVHֆX7Hml].n149Z_dIx[mE-.t}PCco #ް\VSdj?@y5}(^-Rz%sNѢHP:8g>jU{-$cb=B u,d&n g1 "yXl/ݘp% Jb+EF K je ?RLrEֈuI.ZL4jH+~ū4}4s9 8J/h!l?բӜ!J+m6pQ=tIJ$cUƸ3n¬VB̀3?d2fS:|:rN13t' iǚkc >w)=Od]MpCTk4?yfkC *Q["_ ax(.*D:y$*3U0 053#`h'xu5BrWRr,/hJ<$L;U4vmuk'œF%{k`O;*0'cK3-nh̕z,Ԑӄ2k3J1'?Rdm9j(0R叅TB% D+:'i}LP'z,֖tEdzRMk`S @P㨎l*)7 RJ ȍ} R xA#w?Z,DB($Dt5ҰIATmЖJ-_šû/_)]vry/ [FOl^^VDsO+ 蛌l`0O.!Θ#{äi+(fI+"Fx>I6y0#^u9rw 0!XD 9rN.vRB ::1}mt~YvjTNK?,+VΜNZb =T I*o0 Qct6;ׄD+: I9Xapx@힧N;mF<;lEADhҢUcK3Tuc?@&!s*U3E;i‚ԲZ( (בv<>O6ϸJ'*$̕[ j'ChQ~h'ݥuv~`Rdf2/U@g9:D;S+LGOC{L&LbS^ .Vĵ !A!e *".`p[(0vODF@cETrro1)(a}800`+,i;L媅+Pɣuo"[A_ht?$dX3v\Yy]SJ{\S |9Tm##r‡p1Y/V| %=dajTQ>U.hMүdhwv I NtG-1xBhSj߽:.+z-&pUƆ+8ګ==G cߚxP );fawo-)E,|6`C~c#0U !rm<-4q(g&m.4I?<[/ .zWA_kgʞ:=jDv56BG&֤6M$ǐwDb՜P;83f*[@$Bnc ^I;A^A!2F `9NC)\ATL>}IkcȖⷵhSVy2z S-ؼ"\hS X3!:WL]rEk7 õB";!wӓK%+;lIe$R ;n f8gZGW: iC4p g^Jsti @&ĨP0F.G(bQ!ॾ70ٺ| Vᦀv ӻ & }y.#B!k4CRV#revIi%\x GIĐ@1$?IVzVe0+8[J#^jѵ)aH՝Ia$(m- J ^-u>6oE>|/U2=P'H'|YdǗGvD !vokIw?l*cboWD<.?E.Vŧdz-&LLF_l_؋FxBc>Cy䜤N- \z7E,%DEmk␢c\ X'4@)ة*ƵG;vC={/ lO nC&C[fqh;gK_@N }d۰sR:bS睪W[e ]o:($!0E{o~-킧tc 8l)*ZGLZn2, *+?\a6nGaGdǴ\iOcQ͵+u}(L05{ h zhUWtVRݻ+.Dz `i47ÕDsK WF}:PX+fMs*aW1,HD*% /dvMY!'PW;\IM^c'n0]$d_Z;w%Ot,%|x&FaL\ʊܷ_F|52@*@o({~\ ipAgܯ|F\r JEV6΢\QUbNt/ԛ܍.0 qڤ9 =vh:?lJO5z0Z#xRr2@MlCb'&]t/e}"Qf֧JH i(uT<6%f:0a#"2خ&ne ,:h"$ǖ۽l3mlGQH ƨۨhq)ZP:G̷' E6pv,rB oB@) ͺz5/^71ǘ9GY6d[#6lG^2 o]~}Pf=ͷgpi/_ XV 1ĨUI$YEokZPoXRG PBd |)oN 6| ҝZ74 a0&K 9jWpy2,.=Ԙhd}´z MJ&ç0 ,GRO]w~HUJgέʡlHG.hod^-P=d $Ȝ Ѯ6HݬQ>@dَ7zg"Z_tLm, qK!KH28V$|Y1^3}9i\eǼ&{;'}#BΠw؎Kg3]T^`Ώ\XTAOn,.Tp:cjCţt n۵eݽ!IT`Xe) JҵxVN!(9rNX:Nf1.+P`Zhu 3p?Ui?wF>g,*eTL+>͕M0P5|U_gXuoK)\j6B%JŬ;rBQA%,F d8D)n h4%hz_CZBB*_">A jXZR%:r8G9|rf i]3;@$:co>p=u7A G9c+v6̚/qPg@ "%1RUS}_7v3>&d5HO>Op+jkV<^,,Zb@ ?p.] ft&XG 5M&˞Wv>? rg 쿟6Iҗ8s-uFx&ٙ[ p__&:uޯk 5m< 傦O\:n񲦫{gq isPM(>QK` 4 ]8^ @&;✚ B<\kPcFQgj殬dDS9Zý8+I)]"*iR}ЂK]MֳE%F62F{Bg(UXNv㽘uS]TBwb_[P8L6z|Ţ'|elIUd]oLVyIWECOartpO'''-&$O" YQM 6๡o2O %xPz|eC=qmHsTakmǠ_#.8ۈBߖ( > Xh&x֓xYˋtфߏiL}3lLcٚQov_Q5OEԟΪjROOxwnLđj13GH,b`mEQ5lzDߊ8B|B( xS|㮤CS2~s n_^RdA%`T>>Vv+L@+<w}(CE/K/%TM&n*X) g2, !y't^ O|%s9U# THEWjϏyl\m&L Z.ۂ]Ubp%Z8-ayQbb xqU 0 437%J:/qܰtE,v2 rхܗmW}ddx`?mo{< Z$[ЍopԜjsjR=M.S DA_>d鼹V4< i?)7ͭ_U>baJms+2*^QEdCW6gt380:VEN}R6qƔ}S,karYȔ{+2 ۶U92vL2tmu]DRC %79!H*/S<V:*% %S/'f(Wfϐ(x&_E^π6Tt>#Bf:i{\YVh {K[7Z? EvKqxxZUql\o՘'H*@ ?׫fe)-t*93v]Z&!Sh\8PO7EE-ӘTާDӒC/h7oA!;y[; {Ai _l Sqlk%,׵w9t,iWawc8^ޝ ZޝYiX_G#/_*,8˯Ġ]}$4@٥fCD!nB\z-TnDiyo̵Q<'Lk?\#I(< `6XR"ފVhgStc*\Ӄr'vSbU @ϾOijmQf|6A)@- I1F'@vM KƎH9BYMx4**K rL`CTC\*A@+Ӣ0}B H'5m0 s 0##4i^u[8l)gP]+F`Syŏp m}mVʭ*e~07؁Bw%'SG8r$$ ,?}5C~7_@(4Oj ^:'9w8z]46zx|)W}3gXĊ*ĆY q2*0|uOlh*sks6$`mCsǯrMfaǽtzsͪD3ad5t @g"/{~Jna~9vIdt|=+CLX>eSge`u҉2YɵT PS pswNI|UP0OknN%sB‚fho 3>)8 mL̢8=B${x}Z-SE $åޫP<$й{~|wD/%HHg)zn{Hʴd B>}Ow넔*f#P_r}!3yob@e (%e^*! r)8%=D(DGWja$7U)ObU: xeo;d'uxWNzW\*H+/SW(xHDؙ{8o{{`7_( FsԌ_$GDogЖ뙮F{L.oS y9Tyg" v%01Dn˘a9: ăT} v( TJ- E#m{IbuUEKsW5lDQd:.kk}$DZ @]!c[6VB{d1ClӒHt(JՁJNHǗPV޺f}Sܩ* y^^}ꯙwu~ e4YvS8<8V(_XSy 8096'*f+6"ZD2_F{1SX9k{F!r}X*K]2tIy\6z%ACA81kyeyNFܼK[OCirkk99GR#~=1ǛLQhk%64 Oufi(G֨1EB9l N4jq-?Jc.K.2[o]kR}&G?Go8y.AT >F]GRQzfYYlT az\D2úk -%rj .XEm_oQI@ /jHk8W"[&EKe}fMv ^`}Et:u48A˫͒"j[CQOM\UT7s[ZvF.ID/Ur( 魈cbcpҎM)m} i)l G82lZmH8#,YR!ɳ\2.غqmU3gW~+U M: Z=]%opΖ ސY) [b)_~8Z"kJkҞXn uKsb8|cUqPd α*$zhnì'/(e"@2nKkQ Jo&q~;#V%\ISE3n"ft/AkMb L4"g?RF|y+%.~ \]LWЇ0J^g@jԎrh7Oq4[%3z5>(G26(ftrRݗ&5g]hjF`wAKߋq,̺E t:wqf-)zZ,pi$l(M_9 B8ҩmk;L[߇"!OX@`aQC4 ƋjE.Q>=Ri?VgyMQP=~S1avR?4qw"a4]`+cGbc ؇Aa(l|bZZL2h(R=udLjᕜՅTIH`U'uXC%.{c¨`C3v3&Kj X{V;Fi>rRA3I V'% j %j;y'^D|ّke U{/Uh 3Z=xbٮBEɲ̍T#%^PÉk~J'LA?GyB&ѫ.3$ QBBc_S`p5,vey`@a EX M5%ou:~_f4~dT)ܩtD/Feo%8o/sj G6}[hڞr@Y E61LY>i95 )DMMvz벑\WC䉚GKۆM9̠ ډ/{QgY{ݳi!6/ZP\rWn\( 41ɻ| p=W}8MB!cNR# !`Ug )9ԿdU#iG89u2Ŀy4Tz ;bgc݉V1,̪4Vv1s(/ִYN~7^2Wˏmd9#(iKn|eZ7ULh%/N/#_D;kF{=^ ˑ :rI,im xK`'ex J%eƠ(k~ t"X86+?F>oٮi .Ưx!ݬ{+Q+ёI@lylߡ8΍_*/XV{^_%srYR"E8w):O:a/h:jƯr[v>ֲ`ˬJDoxpMX@I[9TάXuIL(aU8S%naM J2yWބS/PI#i!gy S;$J/B}_?qTlOs3' rieLdXq$*:Ph/\}4ApO\]zp` EZytr}xץ1QP Ԙ ZAJlF `L2E*G ?Eyyf{:&/0὎4uדeAz pW fF6Ƃ4Vh;zスn&A>Ilb . mB1(!:W?hYT&RKzW]-=p]6 C!}wWRevP@;EnCzO 0-my#?īur1Rgݾ86AdYQF}튪%izkb4Qa_t*nNذϹ>12I욹sC@M[V8d6" R= wvv6[#apVF'ȴv!It[7zZ!Zs\ϥGyE{\lHbg%7`Om4HG N! m2eBUIH?u Sٔr.sk7su+>V=spjv .[lXFь|SY܍/m_u6g0X xqqt>5d7lX)HPz\[m>6}YAΎlzgm%{JMR$ǼҘ>(]= d[#S/`"}[̈́[^aC{ !,?хnUϰ O[8)@" ! -R\1hcEO'#OԧXɆNl OwojlcU8_$fPXbOt Oؤk/CٲCTJ,B1SyֲKc  .v&JtjJ1ubj۱7G1RfVgaAsƐM #S[[Ļv]Rr˖xTWXr'F~$ y"B硪]Z`"zMzHZm勹ҕԄF7zl#N6lns#`] #|{E5D<`vIW9 WC ` T#ǡhť\r"Bڰd~"t~zbvMDzp>HX[)Z6{"U`-}&cssYDs @L";d>w>HF8.S海־:;I洓6YH[ w]й(K8k={J/GІ~[N^]\֨K?W:S vկMN1R5ʦo>@M 7ݴaNalK ! 5"K_= A‘?ﲞW*`w#'pXvEG Z]#{Nuܚ[A 0ޓ~x5Cs#?/,]ɓVpyUAcS!r&7׊@];P夆h"yNp/gq3+'&BO OR n+eөQ ɏj^scZC xmS%k vD s! Ϣk3oƟ]Qaeޘ>3[웢`ka. jH;mkz*Pq"cOkS%AȇZ#lmU^n}!qh| 9ҝ[@W46(Y9 eEJ(E7Q/$l6-W* (=E*V*D}"waF/_FӔ{ ) ߑF{gk4"/a00~B# x6.K_h*$'ko aHU`A8x[3n<pP¯M0䯖̏hN3WهTB~A==܄y/c"JiBj5g~IIlMPS9B@tIIEg[/2fFKx>hbq3q)?q]!`lR˱Y[eaFqE|)7m{4z- 2  W+HF؈~% ,Sw~}e1;"%L[oZ?7)زn6$3>HĐK`.0bF%SSlCml Pԃ2+$ AΨܪۼUJ+|6N+;ynOOтrstKD[u'8AQj>Hsհqgcđ~۳ /@sWя]F2ᠧ˱:iټ;D05cK+e+3/ zpVH( Ϣ1ʄ& [woAC(Vw>GiĒ'|{e K%'Dj9 Ƈ9m@(q NkvJ9p?_ܗ֘%›"ey\ `qxסo.݌Nl7t oAqF}}ᇕ,\0܌%9@KK_>F=g6b k@ pkmBh(M?] &Qﴠ'Y`DЉB`U^O%zڹZvϰRh6Uz]X'g{f_D,=AwX Afj<y,|{]BﬢHXDo05* QYz}-Qg!TdNxvJizX d֎e{7gҵď ۉ~ ^Rw(_#n@e%:MCTpjuOKvnYBċJPnC2fFL猅o-٣u*jQMuEݮ')D;{ix=~dVPU}7`5:ُTϾ;0K%jWG2I' rJ*)" &}lH+ |#16c?,, W]j+"^~֮0Wn;.%p+@0^tNq5X) oNjj[;]z*,(w_O/H~b5 X;`*󛴺&j'@R7 {_8޳em%3lZ `CΩ/'&P+$0E?/f yeO_DYOp-R)%YEyTbF&#;wlwLh Sچ%Ǭ6.=t ]q^ iaPԱڰȸ$Y==0Tn(+Cvkk>7jU{=rݮR{lC9ʓ>5}ޑ/͗T6xܝ"Or_oT2 M(PXM1pSQWzjm ęe(Ǝ8ߙ'2RmS.=?+ ז$2ן:ufrM U=Z1Zth=] mP=yeÌϐ [zWCgZ4Eku۫@k, lѿ ֻ}-:qA Bg\_.>DCL/EɼY]ETWNV+{K;ocӱͺ|Tsҁ rL;wF(vXwJb55DRɯpJ_aCz\%*5d09D$\ch0xg U9gHZS|oGG7T?ǰd5o /0|KHk6EZ~ ، &\7<š+6Wj3dkb _d^񒿏>,dDd3k PY@wbow9W1?(8y]/5Ј\Na=É|^"Ĺi,Ry^,34VW֭ }S#wL>ΕXʛToMK]$5SitΚ-/prrq.q}tDpUur[4򝗖In=|U4bO&/DHYO @^o/r8=2|` fFD #]5lC b^Uv4-NyqW<{J!Ş:T,TtVZsHR A\#Kt1RZ]7Rx3%|E @6@&"5j|P^>Vv5L\C-|\OF6qQ8Zt@|Elm)pR^̺XoV]e0ϔ[(KC,#*[3W Ⱥ4-yݱ* OsL>ߓ2/> bw}Ekiězw#ԊsbK2IAAT5& HXql8$Lsw޹cq2N!χ=^n G٤Xf AGpcDP6ľKsJReW@G(`=tv,q뽏򰘑dx8\DNGC}HjgXj~DP{?s_уÛ֮,Uh}8CdY)98Z yF)*Dr/∥_e۵A^"4ފT!c}[vYQ\HK+oEw`G7'i X8ٚ4C<@5g7"Wb`KTɀM=߰h W̱?[od 'W wjz2Md:R`b>r -AsMW4Ξ~'Π%+Me#:}@Wܤ֜7\q̋ȩlT]Fo~iOsoUtϠG3TV,c@/GXP,[itV=1!v{JxŘMcr LyhpJH[i\WS 8W!պR>Tg+oU#=q 3ILQxM XKol ?mS/S5.X+Wq, 2jUL`Iهs_Ժe ˇ,z# 8UrL ӋUUBOu1k r /^,goN{g6BV0]ZG٦r,M  J` ys_-ĎԃQfԱ%%]P~ _{~:dvLorP.h'7_PZ”ݼ6sdZo#P@?$Tew~NO.펄~OP> r׺^5G˹ OPLVuu.IDz7yz3lva|.M4byu&FX/maMU.alsc^a X<o*F7><)Od-Htsɳ ޞ0$NK۶og{=*Nk6ky{ݶ%di)]p<z7`1T`lr/Tz¢Pw`+ HDϕ*aK%݋H897h-^b4,!SӂJWg+^I R) S1GA%]ί͇Ďz-PV`MBt+1O)^Z /BOO@=lGޙbe6֊֡xs!#HV?a7S4v-UORNO ?Ř3|ŀ0CYœb2]$!6>!ب/>tdԭ!S~QtxŞC3JU ;~XVwu:F|#o]oy4GM}H#ͿߊWtb'4u6TMzKZLD;MyV@Q{{FL-&2'8rT\ٓ G6 k a]1HiDrh3Az)}^VleAeK|T\XV lRP"NWj:Tć>Io]'Jq̫j߃FMU1qൡS@E3\G71(RұNE<XYՖ|M~0/?m- uQcڮD*.%MrpB~]^z%p&p ۜ䎔T3XP4(Ep!GI?4cG'Sh-4MGDN);#ojf`riOcUnTZ]gǔF^ʠrN;4zyCnKg 8~ܷ>5abeFl/#[ffd/ۤtWŸ4Ա e:FGzKָl]#S?pY2.է\ݏor40F[D* e8$uuA/ );Ȱ `0%Erڒ/u+k2?@8L@ԎUcɠFc6Z$拨e!!MR;|#4> lcjJaߠsT  >u^tʱr'QTCOu0CИ9 eta!Xh"w\ZHr3d;?+"Vm@PDfp)j#^~1oc֪o@A?A|VG%~/@qv /u?Q|} yDtv ,ti@$dkOjy|0]qڶ ;l|9tXY&Si :b= Ֆ/xd!K4bLPKQm}rn=W8 f [.^}ɚG86 N9 BZ%|z>jO $ւGPaF q>OnfGlp;l'Oޛ O܏,u+NN.G^1*j߅f;d5L`b.@i<`tǏow;63Aߍmv N?R&#mŶ~5n -f*(>ZʿGT˔\w-2\d(#8T5=^!j H6eG)ѷUmy.ܔ7UGIꃰ%4kͲmLϱFE,Ua]v e.BVfP| 8Qe맘}i@`wYC*y#n2ą$Py!XS]`hX`~iPX|С4*i淳颻A/,^{.}Ao#&t0 8pc܌ؼD> r &+ߑ8^E7Xճs ]j&=Ո@/bW0f}WP õg鬳lk4$H$F zU[ا$л ))c 622Z_[&v-Wk D_;E͏0~2,MD1Lо`̉^_h+dp[<Jy}~ [#2Xey(`%3>?b lOc:rr)5S]\"p[rHHr'R0]6ѼmE9n1FJƙl- _Pos[T U+\(FAqw@P7Y>{j$5Af6]2kLm {jjhjݿ>T̪ o?$?V9iAD7d%$|BXZ7gXጝ[3ή!ѩcH)=2]@Z=F4*)8`ke ,I"5_Z%,#heoZӅ&=` j>@/z,:ҡiaE%""4:!_aoRج/؞UmcoHdR `Ƹ=K IʈqҖveeIsNJ4ulo9›;ԛ\-#)4"URP3%uhtS,-\]lړR^,@8wV>BglΩoj[ 僓\p ZB^DZv n\#GHZPq/ Lp\RGiE:"HĂWٙћGn{쩱A-Ȝ.oZBqq^Q9^hCTґ|^KwA<bs+(׉ aq;*Z(k{zM@l龑^d+3HO6HaYbHT؍5kA.C/* ~kp"1`{n\-@m=Nc'D}ߤn:f@rܻj{ yIom~~7yzݤrQɱb=:c2:Ex$1bT-#%02ŃDPГ9 >Yp*^+EA\یCEVDTzES޴!-_3%0rbΦwvZ ~̱|h X" cwt1jlkp)lۭ Dn'-(UǺ())\:0J9D F Q~cݞl5Ė{ `37{?/e)@oBwgM?tǃ0ٙF猪fX/),aJQAMa5pE<Lޡ`5,1ZpHکtɟgڴ8T[~TdЊ2vPÆ3D"4 L,UK0]l('Nl{Fn  %rj6s% 'փƛo6i ;7P1'|0I=.8^1vs7 A]=:1 EWOj/aD_2V%G"~XFvt*Ӣ_ !Hya[@AJsVa`?íL/logjp<.zzS){[[hW~ޗ;!5F[7Г4"E '']Vp^E/J>r]n&0hJ@h"x,%Dj?+0{ȗ? YE U! 4/diL,5tsхyZ[ ȒE:?<فL譙xS'~xd-t]]rص9 T8Ru3IP^YO ")! ؤrLHHxl3.ܰ)WT4酦WdF53LEZ|]C1ā/p+ ޅmyF#dC"2~X0\ZqQ~|,߫7!O;qMHL7:.9#ՏбHf: ʊ>Ɉ@d<RΩ󽌯gӑI!<ہ "2MiHmb y2W/P^C xcac) 陑/^J *4 xQ@4oܭ3O?Ġ Ě9X,Y:2[z7Ix՛~8:tKW= ga73~'uO0'KK\&]9+>D!~㱑 =g,zz걛Thw|qۚQ'S/lB//@b׫>25+% $E iߜѢK. $^Nw o{Lt 7i,?5 fa`x~颴!ax=v0v,acqoI2kYgx.Wٿ,gF12jT$hA?;{!D!*I4fο;W4>@mT,;YVcu(RP#фԑ(DJBNi̖AnO=H ` E?Bxz§d\Tim&G_DA:I(c>n*R 4s͗d#ܨq T%UiRW,|ϫkq>= A'"oN{!6_c|:] Q(x\4õśEFAzj>6>~+ڀ4BѦ+dwPID%#0-/Xͣ~A؍j/OЯИY(~kL n*2c~b$TXj@1gFhRGq|7*7|'&.@Tfħ19},'5|Ui$>f<oغ7}|/\qPXFy W\@aq?G+u;3CeҕUF+Hp 65,hj bZӢSdfQD6M.Rn/&B($vL#Up*unN`[_cw|_ N)ӘdNYN%iV@k0*B{v] Β,K[/׎Wj4$hxC&%1U?].toF[Vp N,r`(Â0򓆐Cy"$Ԉq ,$I>`JrqyK<nN6eڞ=d_r&if"7sњ_t(hoRxc]?. Ţ҂Z=|:dɎf,Psmn#R,juD .Ӡ Qz0+'%Av{iU^Gd0Xį;KpuY'P#8,ߵn]XxϦ-ҺN/p*:ښRʉ3kO/dnn@w]' "L#Q|hn|`ŎUEVܭ[YRwkf!B?}}"0RVg@>=ŀ1`\3p 8p*W[z7ͅ:6pcȵd?5&q1!&-Hs4t4,̌XBY)Z,2Hm_?CRo2^YW7XXW͏/LNL4ѽkV o3/rΡt!(IR MdYp~Aże?ܴZ$HtPNm<š0%=BPp~0] &%-a?+TίF\n/~]S(Ǭ[PQF{M0_GVBUFR&`N6ߟ)|Gu<b^h>r͔@lD8lqK #I{S9 t.~+dF! q2 ތM.O$qU⣞ k$l2 A)v&i]6zm.6%_@'ct)8)lczp.(8:5@g_ؽGdf]]qUNC w=yWOӲ>uqx a1 qF VJ٤sQviyq:dt,V'R÷ڲ)G=3 )JȈdi&;'kDQK폐ڈZ'vf*sXs.;w{+GΉc~߲[1Ѐ |oX(}14g:o"3[*Vq`$',2C8Ԛc`S9 Ӣ+*XbX%H0#]oDapkm#!a6LW%5]!bU?w.&39BWQVhJ^|&޽)m`֕XnRQ@U>YUXp\g[7(HY9&f-PH[Pά&󛼵F8@F8##c lul2vd^p^FOJƢI]|$1Ɨ ~hqN(+߉A.]f3&(/]9 ob(B{ RF˄\JC鶄v"|Hm7ukom E# V .CB0 21JӮp"Ow*7/֦_(J TȾg(GE'Ph}%3vZL*[>8 Žuhn47"3/m3}6t1eݣؠL}Op#\H*%p$/FJR0PuxT1y G 9OHq @!{ ղSK~~ypF"A-Sށl> v4S"1"+ s(V_^|q={y <*M <r73KN{_>(<4b% G[_ڈ,4?rTali kIIP1sSоT K;=]]6#PNYZW>{l11ş%U2=@189эǿܿ,\2l!"Ƽ..[6qf7"HlK>,^LҚ BT\} ZX6Ǯb xK{_>'% Fr㥺I$@[Ldևi5D}z u:u3\:Wd":/dsk}#;:JYAID(~='~HX: ϖSY^I0\FI]MHw3m3#DSwHi%۰jIx}#vXq :ҷؼ{<x;Y{wnep:Gd(2ck xAz']Sv ]Rԕ-M`wr !KrXxBF/iwU|0vIİq&zd}Z`~;UiqKg(TL=C^sI1ٴ"č8՝d?<,CIu.&ܸ`+7v=k.7F\3ZͰWJ'3KY$%p{{e$fˍ w{f yƹj+a6$\0=_ ͅ ȇ3['lG;8[1cHʔ&FX'.y[,y,`*"Q1 i \|sVU@5][ʍ$;D%2%:ȯ(X¼b{5Oz+:Qq(7-3~Ft T_kcsD;)|;e}LBfq WZ j<ZfL1%ڪ2Mۉl+tZ˗Ipf6RHMe[)NJ51O`{cŮ꛼,63+3Eb!@w>Lv.yuN6b9?R1dH"aŶWT ,4(9E)TݤpBYP4V!r>wˀ,=ml}/Hk 9`r쳮""o%3JR&hXd9􋌶 9jSQ_*Ok$*/Dw:<' .5)m\nt69l?5Ga#1Na&~j&?KOlJ2aP&Qt$ݒ쇉[Ȥ*?h2ķ2bPyP{cj*j E?ڪA,xQܣqc *5Fg\7xhtf(I5_YjǶVfTJE%6#7~LDioy6?+?ny:@ @$|!;]بR[4"ɉkvlZF?ΕfJzr5`dx5L/pe]jZ7wiQ)s/7ƿ-27gQYHV029~`~wi]sbUvpPL{Z6Esٌ-=<iEQCƄ\*Z[cȉCYDžN_{)l -.nBZjfө_:3B/:֒fa:xY=hľAȚ(C]m| #ܜ3{p*GnuS1Yd$$ذoMڃ@E($*rGFp4*+ 7HNvطg??lZuT8Q*\~m7|-kJ.uɬu ;at#nL?B(3s# ZZ-m荒W&V՜ZFRع=.J=ZӦbpjv~?$=}5(q)".;(k ٛk""c6G]녅|Els.ї9}ˮD+Ԁ0ȜZ`(~+]]Wb@bEEv-[V*vd!QI"oMBoHlD. kqҪQxd3+Ox=/sᝮB+ޝ?vu6Fysټ+/V,Y*Soo's'OUkF?{vd[FyۄYF<iI'Z>ZQht) "!{6vÁ1ӏ["`}X񋽲cᘏJۨL'܅y6s/YsWmSߝ9ʞ;EEQжU*lVT9{ Z%/>D~]CUJyBJ E/!;2(,4ewe  խ c9#WPr -ˏ?=ֆ}BR e0Ifsi79T^c?R8HJ!>ֺ>EfpO+MNBf\&XbR>u[E6͔!zw Q>Y,$KZm8e4/RuZ[5aAGD~\6~ D"v)+sRgY6ܱ@PI |RYe# &-6xA`ZHI%ڇŅ dg`*dOn [HM~%ak'tČHM T5hL93B`(Ċgqt R'׿ G ɦcjSoai/s$(Y S^$o_)թO& ?-^w(Q+r8tiUjnW :钑γ9rbes%ڈ@?Q>a%=%XS`Jj%A!hJ‰QldqU=:k۫b]躝7OHp"Ec{ Ün3-b7”C< F(֨(sgSfroJ_Ę}HM?>҉&1d[(}SR$FrtUnxWG 4SK+&O]D-[onRHA@S;0l %`cЅ#]1qJ`YHs2Ƚjj_E)`W98=6L{sy링]C2#fppH @ƅ2ZS*Sn:`&̬ C%}eb`wYo 簞l#^JU>f!gIN;< KFP]C x9aznl ?Ѐ ];3"Ž(8mEƁNa]ј}'˔>_{'65%Eq]Y1"E- Kp@,f few I Fyn|i#<,눎IJQ yMi HMѨ@;ŴEJ KW@=خj0ϸ+ӪHyבм;BN@_ZƇXrWA6pbCwXQl][厲Śg -,|n9'#  :Zg`5*+,& 2T@k^<4"TVR Ohzoק+I'y뾰1h0BeZ?KU# 1BO*`!m\h>Zrz!c= dNvپ|5cHf#h7KI=5h}[էbR1zX!:S,D" m\ !@5~禱G-ٴnx@hv;k]$n0&0($-770VMTݝׂ sKUV궜5lw2=Rtap}DmrH엄A|;An:\јh/ ٗXŰ9]T.lúJ&n{W֘? e^}%Wo;a38*nMn>dc|BB^+DsC] :fͥ[y(4͍跺19j3'͸AlE0SM`Uh gku|myMgBPt"2 b`X ~}"L(Ͼ&Nqb\~91/nYBT)I9Cll"GO+>&/%  eCL F%s:{# 0z2[Tt‘Ijbqeup?1S0-n',Wm~Wؘ럫Hʹ7pj&@6U~N'K$}Jz1 #~N}dt+2O(YJA(X0~<c#`z:kxup,^ ؒka>3yBk+~It܅GO@xlLu/I^NZ ]-ưk##AͭQ ~}۝"̡0*S; @%{ nO'+TM&.'X|@;8DwEwM[ǏN׀<2rArjhAIPS5Tu8C剼Wɲ Ər.D,muѧ~/|E)Q#X+ E:ssdqxjcM٭.&'e7h!^@4ksCiԖutƯ A / $98:^ UD# sm|Dj|Ú酹l|_K1 E!nbWŷ#j:T3ܮl&w%j>YHa׺fÌXqST#/`'+ anlE^#wTI2_P/]u(ε ֝B<6QV767<7_ B9ǹ6;FCxT~[C)@E)u13=$Ci/u"@!#F JoNH,g`=G靰x~6]1E|[AՁi(`Y[-u4r~]3׬lFQGF?P!&[RBAhk:4XٿȭGiFh_[M,̆S/!؈׎az;TT5N5p׊,P/=vQ2~͠:%IFs ԮQo6ǐ>aDtEC`gg]O> yN 6JvgRMWd`^rs%g7`C #r}Rn^ی42PrD&wPN/"H AOṴOWsC 5Ǎ Nƴ+3&pKnIײݽ#޾vN;Z!8ґ* 4w2rL@qW ڱX#c Wi<٘*" :`!E]% F7q9T}G%y.V!W`U~(f33KϽwy`vsG[f4߱Hw_v!#Ele>?շqj<'O/o$5 :gŽ ntQl$\!(&mf7/;K"O{ ;scGզ h[a AVN *ϧ{U y(]O>%V3P8π ejUW2zᑸofuLu"\`$*-Va< S($as") *&uMZO`q&JFN᫐X\܅*ݎ' d"T+P5D>Om/HfoN3=m["FD۳xPud[b^X @2)x9̬f`&#>XXs0üòkӯ0l) QjAG9tw(TgzH}$8X,yZ)210OȤwGF [MX()ԠoP6%;G>aFF^GyD.ᓼ ]% . kD@\;`0:]=O>״#`qc| %/rb96Iڞj\lsp)dE]̾h@~*; {EQ9+ۡyϼaЧ*Ĭ2qƁgWxâR`";=no hQxsV0cG㏜O)1l,PICyekYgŔFI#k*Cz[26eƳe TH;0 i"#?O hA_RӋfUGQy"HHeQ?>AБvD^D,jk-cgU/#}Q(j׃[4xq Kt-mpѼa-25l3xHcρ ytZ >:C-+ASVK{Cmzy!VnErrY!Ω1 r-&:<,~JT0d$kԃp ))M<\4@L| uk$wnїڋo;:DDz,)/n*&%K=[[H(װI ie KFpt #Ҥ*:}%7ipi<o?EjcSmmW$o%䌣ZWBlpCkX6OB@ wx/%OqQdM-?^B[OkU E߭ ϧb9{r{G>6H|+"ܕV#| B*k\;bٷ;T毄Oϣ \W5Gg.!O[RpRvޘ~35IOi%ꧭD~GWnb [b𞣻ws.Alm (qjJNV .ryB\Fo=L=`p1!bY*qIHj |%f NŊJM78ý[4JyPJD1+fɝ9ȚUSz!Vm 㕆s1iM݋u ŶE,Y6(N\:2Ci=)%ҕrdfOw&]%wHɽ"v)ޫ4I=dKs6)x)S;ELAamEfcnH w5]GTo&\0*_Z^[=Q]4?qxC$Xʍ94$Lzwy̴K@Ͽ !#e! ĹC{)M¿lL/SD,Hd (TnϢ5$! 1y[$'r+ֿ)[D8z&E{LVht,<6_C!P~aVJ>eQY?&gQTЀOVN?:o>"૕Q25 ]OXqFH>#!ܴdO"=)#A1._SI)g6ED5otBW"<~=cV0%̇::BWoA {r7ۊ?y- ^hQ4a#SC fmY՚I_eD*yִ|߽2%k *JZtCٗѯTjHrUr6uGa!& 3@b" 4eіDzON4?\GHa:GSduJ`d~!Hm\j}`6.Sd]p+|+UФw/Q9}€&* (/"0>S#s-%BamlAHg؂RU9 v>wv.?&k -?VЍ@g FuECZܳP=A wX. PjFOCh&ϊ3j2Er"q-WASt'!{ZƓ$DwmӪOhJ?; e;|_>O]$WW]OD6m>6@''<%gdJ;iN:D>U=o%Bk0Qdfe9>ky>ɘl 2TZp8.%OTj^P#KyPAcΈÑbȽ4^@ik IZ}g vr~L9>OZSTPa.q d3k ]AQWߠO=Ɂ~ "v;1$_IvGԝ(,5, LUH"dڳfe3vGR~ͺ7| u:]WЩ%8]Vf6{wmY{SY16n܋B? 0\35-gYX;(Sܷk* Ie~T==T$jpq@ll ]–âPM.jT2P4lB>zn G #rgFaɸ BT#*^=*QTÊCB]7S]fl? Kowth L]ܙ5=w߳i=إȥro>m *p8 !USNX|A GЊc$lŻ60mS ޺uo| q$|y"i+ǂä#0q:SQ՟F*k.16G.o=Mek"BDVq1̢Mޖ)L'X.w&gg!k:̍NTF`60삓6ݔ$V-$ނʏ#t]:q #q$П+.5v6WU]9U2W90s"4Rgw)ȎL`HL̈́;ٞVXUP ־]clM"&&珧1yVsPWGPïvDC _]a=T 陒; 铝(cUqEԦe4./{klg.K: պM٣|oʶR}%>r3V[Q/ Wz(A40m\ȴ ;eDXDž._ 1?b\RLzwdAbd`6ཻD=x )Xn21_l|j*4J҂c厬rduΣ[ڤJS#?oѕ݀W kΜSSt§̏bgcqxkDIW]GA}zH8`T ƉljƝg³. H*7(?K>4p`fFP(m[ʔ&tҝ5&uw;[ڧ'` GD8tG zQ5eP =zs']< ^9{/=12`ķsv8:ڈ)2 o'QJ툆>~*K+vrLF715N`))תwTi3P *Z4(j LR5OJ_?6$V-κC΂fZ'c7,K{%᪗ڙ4rGuRN[nWdԽ~7nRE&cy"5+"$wHDb3|7p ƶ8:f(NvZ98)^Cc\};,TS~m·R?gFS6]n"xe+Rg=v{4wqta[<& ݮͨ-G;~=%jG\ۗ~ fGd2!'@E4܍iatdÃ-kN}e,C*[_#cm$lZe 肧$;.J4 zsȣro sK fw$/ɏ{BFw8tK28fǦRB r6SAA{BeҀdQ,0ylH'lX^ Qí f겱Vh4iѶI?AʟX\ˇ} t$ 1 -懓z5&23!5v{& .%.C}ڄAPUG->$#Drts&i&GM8|pj?5X:#+6$-eZ5ԅ"Un#FiBxePa2LkCLVgi[*d+ﺲR4MC]eʋf7(MaCgCC Wټ8q4Ueѵh)-su3rLWҐi)uV˱Po;{XYK+m PDؓ(qs lܗhYJiOH;,tLB96GCv2j+0z xy;"\y=/9@'6~nE- c8AF]}G,ut֏B|D g3å`☾()/szj8| =.`ue4eᓗQm_vGf*8Z*7r$ן Qo..k 9I<@ňLj!*eF3#Y+R8(̎}\&AƸXO]4BZiZl$O\$(EVi@0 l.yM؆#}-=uRU Noƛi]':-ŐJ<&_fӽM!fYJ3^2.#G'/Z! n.qeʊ8lP 5 un'%Z =@QFYfy؛%-AY_5.WJ=V6R;polle @ۦ*bnX63^O; ZF xyfI/ԓL:λ)i3y62!FphF зmLټ#gKƞY3h`,࿛sj]vXgJ /17՜n,plTKIGm9C\/pu>Z,YP t-ɚ!zj9sc}[jsl#,"@59Apw @$?]?;VEITS窜";V $พ}ޏTZsxDX@K  <:pr3k x\C?˶o` L7.:H5>u3$:l=d5D5=WG2 َl(C43f3 x XC8Qhuhg'_zԟf;@+d]|b[Co)V E8?O1ǥǬؙsUऄHg'Eyx1NR=ɹg,V+ bE| n"%g>wO<\q,*U>}ZW!(9 [|vAxfJ8iuD;J<6 <,ap-TSL3kA}[} ^ATS\g@ r畋m{NƔ5z ˼*@Vb\ÚMWl V\G8DžӞD3f}>c[SQ_WSd'>r%0/G@|R8[3WBљtWL.s}2Zk$xfX3>d0K y5@A+ lEֲd<`ktQ̑;q4< ڌnJveT PYB=14A:Džy]eaFVfmv mÂA\I!K4SfZDf-3M|k۔Y[o7 1CEpRq qӴsxD̀̔˥/au|XE`_DWC/]`g|1yyt{5}&Ӎr^<[0ryءf@; i6=&`~28(59x‡@ ҾP. TABV+ت"30WXUK9O'T>B%Y;+Cxf%8 2>x=P4,M/^glm;4){iM?6&P?0G4n#YwQL֝v0@C{qom\:PB&u[kw9ydbٷ}a6K:pvP8P a|ƗP4j׃FMz?sA}FD.uiڌPL*4U׼&XvFχ7krd+ڜ, {MW1edyvѧ/~u*7c L+s6򔔂tp`vџGPȗ8wMVqF g,"1r̛3y 1Q|B4*lo*% S,ޥx#69qK Z]Hޫ,^{źx9"V̄Θ{|G6D(9.1..d}w$"x!\q  *DDUUM_%UB{O1Z iSx ^Jx +E;˛ᜏ} 4?CT(O@74\gf(|X P]wP\0%I.)(ÎLE^ ;.ԞYV֘lYr~jJ鿺;o(l76^:MWh맖:XU6O6<e2z[b 8 ^0A( =.xU.Ňf밳|ccwS)#[\H!'/7BOv,>5us:Y3EK9Pߙۘe/rд4{2rasP0`gA^V!9/`@"qZ{fݧk_&5~uN@=ئWN݋aABN:+{A5yYrÉE7@R(K[әe;a1v6Q,i4t`֢5%ޮ7|%24w{P5:ΰsS6q)vy+>g) r z ibVOiv.RF8H~,L+G|4bI쩗hO5Y  z:T [(Gp{ٯkDai{=p-\0n#|lFbt{< B*:=t. kj㳲Jlu͛@1o)tܜ-Bܱxv[}!$8'o\RX"h|> ;.ǂ@᠕P} ,.*5A&Wuҋ^[ڟlkZ2vjQkt%kI'x2 _R] Qh!ķ[|D̋.-C=jBIZX*v1e|2$6HgN.;(PAC*-ӐF~FP/=C/(+gl]`{nWmefqMl|%D0RNlc]x Ԡ5'(3B0|N6iPKθ \LTu.y)(gDJBD:j=Dž,+8i2]hGEped2A@H"nYj!hQ3zcKyH]˴[a{3{ g\rATQ|+4|i>~>I2DVpo?࣠m%9]EѕMΌ˔IJߨͿNBO?LgTnGgrАyLXzJAVTB hޚ40#Ij]V82}i#1ةֆJv3[,rC ֖W_ymMmTq $n!\$FMܒ4P_`2;6G8eeou/X싊Z|z' ÒNcZ%4`DܲVV 0ү}: ^gR.(wٝ*N`q[h/=h -Om|+1=I`cυk >6*Q1F5P΀S[BXy"%cQ~ sE2uC&8+g e! 8@Vd@џa|;d$E`EذrodOTe1on0|=g{WBQ{_/^̞C]Þ:}x֕HPJVɖH@p:0y/sva)fؑׄokK {)z~ʢ3rGj_qư/a@-Cu yu!u dK`jl;(\$81 鄉U纫_>h'X=l٢?[D+%ۛ c)8aI<[g݊U$MFJptַ 5^\ `#+Ix`s.Il19 2! bՃֳiDq ~B iv~YڴB'~V S[bctfX3Ǩp828hsJU6X?㓃C)0cz}TqjFmյRݭxxb9F ?"&y4FMK^FOa1N{f=j3/bp+;z4۞*̧g[GjG_0۵c]@&)DUpjU#㞓)˼BV v qhns'`dj)f޲0 rÛ٫e4iX4a,1LznL RЧ(AsԎa*e/)o%M|~#p5<#qx.%:X+wbs߀(Y"ء_]t#φKmj7yIA^=6cyY`kH|jG+E !n=hst"I MH=p˧3:JЍR۝izRP@חkA09uEFkucJ<<0\ Ηà$yOlL.P"<1[-J)M+S%1دbM a=vJ|E#Ma Ro.DuW*$ڤ@jZBKjE (ԓy5x8LByK~g7)\VoJY jB;"hl$֏ FɥTE*|c Aqyw7gqؿR"yh3Da6`7_>Qʑ~R8ۣW }u=wQ-`KrS>-K7w @+nP_sR*F;*jΩ2[WY,H6@!m! H߆(DZc6#vAepzZ+w΄:_>' ߒ /d,irWAlhRٖ X4gG9jd?-$kO 0xQ (M=oY=JA)z Xٛ,@&3r(Wdxƴ(m.+BX@xέ le^tr}߿\CɆ@{r!40\&E,dɴC.<rF.խVOwvFp$%$ߊOЙبPϾm4%mQs@D6Gt![j!JZfneWXts\VӚ@¾[.,mgx6:kLPo!!XF.FTS3#g:gԛV `1m*}}v?_i,Fb)0,t=?|f낺`bV5o,}dYeV^+2Eqo3" t~¨w<l??' ZXߦ-9M.|ŀ壌 SI44W_0k-urQU^%^t/ S1$tTk5~ -vp,~ I~k΢LeS3Vxȟg-OHϷF:q!l{e :(*ZUIH!?Ϸ\wEm̜>WUv9bG3 y!1^S|if4F$[ϦtVǭ7pɕ#Nf dJ:^^#k c6ިG~v}@LY/Wx%?bAm.@8kM$OP>FE˫BDUElů1U<~݊(`0ʈ:Bq LliqȦ RixlEv^AE} ۙ-)02}&%Bhkm1MZhΩqVbal8ALج^΅yJPN=X1[%C)=%hC̆M* .W^'. L3"=e' Q^oZ N}d:7! Ɉ"DL.Zr^%  ۫ lŒ~QRDz7s.@b/c;$x- ni 4qZydQ3 Ur8 x+^\>wu@dLR&+ >?7^V3enKߙdeXscNCk &+P}Ȱt6(spHiL$, |;ؘ)+nk_i2At?m'ĭ9:,nRE0GQ^+RQKV@Mx,ҹ.Y -~᱄Ms[*jd#AG᳕hD?o)D+;*-ȓ~h^_eeVzttPexyF, B,pH\͹p!gF1Wf Ԧٮaw4L:df"vLjHM[IE1_ b=T1MaїL::|U'0&FDԲBY~e> 7KzTiBZJ7RT[aM(œWWS|0|4]q[d޻C>0p#L:t"%ϚfJb{=yƎuG&L_^;8ji&AI'D v ⇗U=@򍍬g3ek'Y`G[Pc|Wu_Cd}">C A0-B:7 ( pPᖨ/p7ur2nfaKTF5 Mi 썫Hd aG%R0V`ke|ῤuه⧹r+Ȉ W6tmK~8Co4W_C>P>a֗Xϕ|dx&$;HĻovlHA+weO13V[r|ʛXXapCr LZTÔi'l)Ɖ&Id,%Y[Hoq/H{SLQ5X!M}e3nŤEL=S@G_@EoN F]AXo$k<8%v$ww!:ys㺜N #_15 ܲEuqcdA_DO'[.Rm$g Q=`>O:XDkͿ]]\ͬI"V. ]Ц<2y݀DSOFk>nFiq_S`1}X ?珔́X ?lmFȎwCCZRX|~%76; 5 䱛- ^:=9Md,G Vr y8M'pt? HsUt-LȌI㼻 x$ђsסt"7lYrFnevo\\x}|_W缍;س`ͷe̶&d`,q(}m~/Ey]z#ƪzgwJϨ^4 ?;nN }!pa9(/lgBVgZpaO#&G"@+B$-4-wqObyP 2۰}VJr5/a`re&ɘR~(tB43#g U<'Y*%|XU&]GocdR/ݻ\.0: T~-ӭWh]ddlߤGH͸8QxMDOeT )Mgܮ/o: 7Aɦ&=vy ƾm9ʯ}}yex8gz7;cSaXxyKj1@KU17hm-ȗAIޠ8*tP-q`0럭Yrxیds~ 臻{"C@>@h.X瓺_T3{D2ԬY%W9}/УBiA)#\ՄKZt]AOF\]G=qBr$b>k"=PA'pǫV˙X4qє ҩ2ʾJ^U 4 tJWdj)Ѓ2l0ŷ{6x^?KЭ1|Q[ p ;&G)EwUx|jF[*{H a\HXm=UbfY̛4Rt$'9_c&+clN$Hyhfwwqps_qO_ތNGB\(}a@!8Kh`!bF؈\BgLJgc XkXsaO\b(VF+ec*fQō6&Mg% \,hx1k$7rD1QXi%5*qC3}kVwM@YXEHL`yX;Lݢ{ %BvCO /dRfZߕHsF2A氠w\Ix--+66ty2eV5S}X JzQ] h$y2=̲ FMnt(󇾼FŰ 5uaI3n'FO"'x]zFWȵ(g$KRYr&}(zys ` x-,F:O{ukNybd*DPQ!_cz$mxD@6U`!YARMq LNx1O59o´-rO= Kj>^qP)fnSգ#-LB鄏2.GRj>ynN_(O@rQD_Rsnטq1mfSWm?C%h jtVzRJeێE| Ȍq\:b}K6^\*krV_0${zQ1a( 9{4뼠NKM!,+7'o'/CO1Ș kar6tAs3"}浲A ҰvҧZ/yӣ䙪+>W WpǑ{%$l7QAU:Ła3{d n(S\0%X}ejl@wwHdZ!7 }vNK_X:7a^!Ա~[7@N~ f XUh-&q m=i$o~sas6(Z\Z-yqX5Iag\K~0+)!+^XYLl}!k]=̈́V[l.P0i-0+T_cQYaW ;lǚuN6v02sace$PM LUJ|U8H\R qv?\}@Q œP?|\gonecS ݋qh"@BJ+2wɬ$zgLjʌIFϓ.dLD7u; w{N;}Nǵd]X՟R0;D.^KP|qk@]B_\@bt$q;Pw7 V >M>o6{1 k{.zCxL!|}R]1p e Įђ OCΦݎW3iiDG(_SF N#_Ccbm HsRj)͞>8moW,\Y\Y*" Uh77߸7vá2*fzWL̥qJX;H|i`ZE̞ P\E4WJ!(|ph- D 4P]$%6 YavWvTŅm7zV1*Zܓ&mqL -d`^8FP} P1:8U (iFX/"gChs&_Fd>]м G|Ҟ'0G r>Z4W~/ywG#{|>4˙t06e-OkL0Y h1G6iY1NH9Vq,AG(cZÀ)! 'oU6Nw_o2C3:4` A[NC$Bxw /{fra~O۶d]rV\ٗt/ H`Pp(<2X2Mjρaw&ޥEO3瀒cmP6~{}TLD|e4Rh) hP0TF*PӴ3d OqZ&>'C^JN|?9?V 2{^xnK:u4.-[8*ߥj#kq}ab+s[+1WFy 『* WT={45A<B=Q O mQC~@:_\[TIv[ cY׿yJ파@8d" ^A o2uJgn,\GE1 H]3tTSeLׇFt &# L) *z+2޽ȍIHC^<=n ›-VUCDTLJ%NgKpNa-lX eO睤M_\a4lxpȀS9Nex^ Epp`^ (AS.%v+m>CD_1uMk=/0sc&n#رgWImth1LpD Ûu)J寂;a>.HsH*|A´k0|'wj@(=.% ЌV8L޿=D |51KZ~̷%4m%6Vvp;Z.wD fF@ qSlI$LKb_w*KiKu\Ike"+0f`,PLvsٸm."g[gq#ftUD7~7ÌOd}c0xOnUYa` r9 ?^iȗy'0~6-M&f/k(i[L8 a_oEJ*JnS v¯ 29zlZ,7YΛ sg":~n03I|gdJЌX ks2Pҙ>ޡG {~pD:O,~Ef t)["2smUAM^-l~S~|!G(b:/pI'?i6^.bԙn%ɺ 䜓4+˗U ϟiBp)pwחdX,ۣewĊ1Qʑ>\5Hl0[GX䆕4$wER6o_nk: ꔇRs[TEu į#oԼS +CIStaq];J`}BmѬsmXWm #*< K#( iI~βS1xð\7;NzU )F&,`B3C.aO PcwGYmvX)RX3"F? 򈝻D❧R/HNE _F7vq0!zQw*:QїlJ/pBf%|3,J[uȼU@iMxn }SdQwC|c͈zT5f Z]יgUwLoHhIKL{TlKmbܢJ2#S7;U2ϦlYm-.x`qт%O~ڑUϕ y]El5qsU$};hD9,LJ77A@m;`q9ߑ RTc; ;8WxJ0y9O;x--3-,;IZdXHmjr{,WWLǔ4ۑrz8c0{pGD3.͗\]wu,+&ie:6涫`k}bg Sr)WAa˧P>hFHT|BQ45_??2\:aX?.Ҩ]#4DhѨfe'QeֹCaZ#҆^L9N}7ߡ+85Y`G=55X#6B_;1"JtwgG%[Odn\CR" ʅdb\Ph4~ wj-y 4+@:mN$RL oʝ`-5XOb vʓLWN=z~= G ֖NY7(mckCrB/קn%rT p?E@ѺM6ҀAkd/*nh8 +Zc,ol`: X'2_/\a,B(@ݿL jA[ .ҡ$62š &+GqP3$}2΂*s$Iݰz.Q#~_Ƥ&b>ѩ>l_,PZdb_.m9?TTW +E ]H:=?PBjl`O\-H ,M)"&btqv|F1#0>8 r:[YS30Y~zK]=&C~? G0]ًmt4&k~F:umᗏ$oQD :I~:\"&|N F_7c7%\˵AYton\ueO>]t`n0yX>)OBb(and%:XLh҇O3C3dDVH Vъ?yuGю {Ga)kڟNOI@x֍fh11!8䶲ip3EdH۸ &P-\9?z? 0I/Z{"#w; o526P^Bz=%7F[C ȊŻ%b(@},+*n~RH-:g`=E$W9a=xFr^-dU֖E4 ,4z 5"41"6 -2__7Tq_9ZDdUZOG@(9L%Ț=]y)Ft;ʲ0U/LzW~U.Kn?Iԏ¢'v_j!pqPl-O&<2|M8:Xp7m,<&+ xr[%g5_bНn Χd!.<4L^ո o]ޠga'LOlcM̩ӄ~aV$tPkm[0Sz`?NNn' 4$f2-p}K*(ꏷBGcs<̦,ZG`@NZ?Ҧ~SVu V%8<48%:&<^{#N"Nuql=[6cј5~uj!f9mo*2ʃ] FƓIĭT,)Z0౶F5'4°m뽦Jˍp-?G{uI߇̴"=VRRÉRh"CeJ^_ $K"qA=3kċ8Dcg)W]D61JJS džډ.ɒqŔ_Z/1U{څxy &6"@S1=6h`M!-6Q,{\Cip9fm==IWF,H͆Xyo 72=XVeXiW~xK3բJ~8Cͽ,d$`Pʕ( Y 䒪z(C0͇|+{5aEQ! Hrٮ3p[Xkrv[cfRf"ukָxA8CWxb-}p )aaei