MZ@ !L!This program cannot be run in DOS mode. $dȞ͹͹'a͸Hk͊HhHi͋Ͱ}%ͰͰ}5͜͹ͭ~kͻo͸͹1͸j͸RichPEL0V"  t_@0A @@@p |@ p0 Ll0' @`.textO `.rdataB@@.dataT b @.rsrcp0 @ 2 @@.reloct@BUV6.u&E0jj 6pHt} ^]2UQEPhj3PPPuXHU4SVuWF@3ۉ]jȉE]MQjXEςEHE܋AEAEA EM܋EAEAEA EEtM܉EJEuUEP P~wDNP EPhPu ΋3@F >M_^[M롋FHUDd$SVuWFL$ 8j^τSj[ԁOD$$AD$(AD$,A D$0L$$D$AD$AD$A D$ t L$$M0SL$t$t$`H\$ D$P S~FHOFH<xd$ D$D$PL$zQčL$ RL$4nD$PL$8fD$HO\|$LHD$HD$4Px;L$4rL$i_^3[]iUE;t]UVW3j 9~vYYt u>F~_^]UVW3j~~Yt u >_^]UUBABAB A BABABABA]UDd$SVWMq3ɉL$L$0-Ej*@p|$ u{j΄EVj[bND$ AD$$AD$(A D$,D$ PL$4Zt L$ VD$0PLV|$ E@0~FL$ 0蒹D$PD$PD$PD$PD$$PD$4Pw ۍL$ ~UT$L$ T$U|$ UD$U|$U|$U 3T$UU3ۅYVj(;mVYBD$D$PEL$HD$0PUYMA0}v0Yt$L$Q05LHUL$0G_^3[]d$LUSVWM|$許N$蠱N4HNx@腱jdžIUYt 8_^ËSVG3ۍN^:^$^,^0^4^8F<(F@ ^[UQ`L3ɋ@Mǀ`LlK dL hL lLpL>hIL>C`LV3FFF^UV~ 7Wj@YtuFG8~_^]3UVuWVgFGFGFGO F aPgF0G0_^]3҉Q3@A QQQA,Q Q(Q0SV5tHWjX3ۉGfG___S_j[G SjG)ShG&ShG'SjG(SjG$ֈG%_^[VN4 Nh苯^VN|NtN$l^VN]NU^USVjF [9Fu0 jX;sP3ɉF W Q~YC~_SYCM NFF^[]U;E]UVjYuԤFF ^]UVW}N$t]~tW?tRV(9Kv0F@v, F8P7R6qF4F,Hf8} t ;PF4_^]3U}= Lt/UB w$Lu \D3@] 3V +FV^V V-Y^VN8NN^UVuWF0@~6FphvZD_^]V薠VY^U} SVW`Etu{utωEܽGIȉEQ]@E ~3u} t L譲};>r E _^[ ײU uMP LuMUVW j XYt1E&HNx0VGFw_^]f3UQS] VuWM8!_^[UE!Ax]aVtQV>Y^USVuWV3CS6Fpgjvҟ_^3[]UQSVW|jFτej1ԟfuPPSPwE_^[UVWO@NuFP胯FPAF(F,v0lF4F8PX{AFHhFLlFPtt FTQΉt_^]USVWًM hIujF81j8YF0aeh v6?13Ex}1G(E1M誩EPEPж1M EP<VHuM诜EjH MteQωw,w0_^3[3?UD$D$MP 3CL$8莛L$(腛L$|_^[]UVtQj YtM^]3UQQVuQčM -^SVW`39ux4l9u 9u _^[Ëy獎0V,IN^]UQSVWL@DŽ8LXKPL:H43SSSh JH99L3939$3F @9Pt5MQMQLP@@ǃPu@HOOOO荙hLDm4aCj6+  x{sx}lr$˘赘^_^[Ët#05LHtQ,F;Wug_V+UESVYW8\F >C_^@[]UVWy)p EF  M _H0^]y AuË@8VW~ +~uNy8tQ~F _^F VN xqVY^VtQDZVK@5N^VW39~wf_^ËF46YF$G;~sVtQ~ ږNxYN4YN$–N^鹖VW39~j*f_^ËIuVIuVIuVV~uu^Ëq$Q΅u^vvYVx@DŽ0xlKN1|^\UQQVquQčM -^VNhN4^VN$ϕNǕN^龕Wug_V-Wug_VqQd΅u^Wug_V)VV萿Y^VW3DF|_^ËIuV.UQQSVWjF^jjuE~MvjSu_^[UW VPYP3^UQEPuhQHEt3fMVV9Ytf|F\u3fLF^VW5H3W5LWWjdh,PPhIPPWW5LLjPWWWWhPWhIW֋5HW5LLW5L_^V&KGvY^U]UQLSVuW} ;u^v_--HH--;=!LuuWVH_^[]t2Ht#HjVHLZ3jhjVHhIH=L!LuHLjHQuLV>U=LtP3hPLLPL LHPjDžHDžPH_L@LL׽LQhLUTLAuV Wug_VĨVL Lu2X^LpHL0=LueLDt 0$H뫋ЁVNtAQFFt `N^Ã&V6趻V谻YY^=TLuV3Wug_VUS33ۉEEEE CS0M2ۊ[U!L xVWE33FL$L=L=L|$|$t$|$|$ t$$D$D$D$LHh1CL}YVY !L@uv!LjpWh (H5LL$XL$O_^]UQSW3SEPSh ](HEjSSh G(H_[U VF }^3jZ Q谹Y3ɉF9N ~FR$A;N |SWF 23H~*F DMыȉE,uF GH;|ڄu_[둋FM FMLVqW;wvw VۂYxt 2_^ð;wr L LS3hDI$LL LfLLL  LhPI4LDL跛TL譛dL裛$LtL(LxL,L|L0LL4LL8LL<Lh@L@LjjLZLLLLL LfLLLLLLLL LL[U0zSVWMƚP3h]] HEPus$H\0L3G!L;WEPQh0LhHLM!L4L!LEEPPh5HLHu L,]50LhHLB&}i=4LLuW`L親=4Lu tPHM_^[ Lۉ=LU4SVWjHhjH5Hjc5Lh5LLh5LL֣L!LxjQQCȡLEL 3҉EEP LE0E#U܉U]}UEIMEB7@ H5LfL5LQ_^[U@LV3j|LE0E+uEE؉uHEEEE E܍EPuE&KEA HhIfLHLEPEE;Hjjj!jjHh5|LLHPj5LH5L^ UQEVW=LQjj^VVjjcWxH_^VIvY^UQSV^Sjj8HxWjhJj v hHt_^[UVWhP1HP)_^UX讷LVuWG~֋$֋u QVwYPV_^UhSVuWj63ۋM]]]K#j6M7E8$ShIVu V蕆_^[ UVWMYhJuYY jjudHMF } P΅ F_^U V3MEE t VMЃ}t uH^SV39t 6YNu 9^ u^^[ËQP^v H^ U eeVM:t 6MЃ}^t uHVtF^øC^V 39F^V~u h$.KHth(9KPHF^VtF^øC^V 39F^V~u h$.KHthH9KPHF^U(SVWhUMP3KDKDB|jEh̵KP豪 { 3kE{3QjuE|cx3҅~0u3$L:Lt2 BF;|܋Eu{u$jj3ˉu넊L:Lt-@M\_^[]}t89L: t뉊L:Lu*L:L izMUQey uuu uUQQy uu uY VVY^UVE f,f0F(u F(v(u}tH*^]2Vff FV^A( t A0jRPUSW3ۋG(_,_0  @GVSEGSSEV貮YPMuVuV|jZ;rWtSjY;r >[t9_,u=jPVu2Suu,M8^_[èt=~uW,_0UU S]VuWtttukʉUG _+؋G‰]]E;|v;uroGEEEUm;T|;uwM+ȉO MwO_^[ gg vSjRV7HϋGWŋuU UQQjEPjj1HEUUEVj!YtF^]3VFuvj6cYY^USV3ۃE VShjSjhE0H>t3C^[]VWN(_^UU S3Vtu 0w@;rt+^3[]^2[]^[]VoN-6f,f0^V"f,f0NB vZY^VW39>u~~ ~~_^Ã>t6 H>Vh&詫YΉF^UQQyuYUSVuWڋU Ny_^[]3AAA IUVWMEMUR39w mEPOEPO(Ew NMD_^UM SrEPj3Sh|Ih H2[U4`ES3V!LIWL$f!L!L!L !L!L!L!L!L !L$!L(!LI,!L0!L4!L8!LC9F s4jZ;V 3ɋjZ Q̦~Y~C3ۉF]t]j 覦YEHfKfOGfK fO f?~1jYf;f tZ]Ft3t3@3#uu33@U VW`:p6MQMQPEx}t HEA_^ԇUQQVW}EPEPWE?x.OEfx,/}`uHE A_^tUeeVVEPu EuWxME3M'^ A Ht!HHHt tHHÃ939I39Ay AuË@0UQS3VuӋPHtI TL@f9Xu8!t t^3[Y]UMSVWN3B3RBU؅J TLKf9puփ8 t8+ũ8+3EDfx40MuvL euRCDfxGuOuEPEPEPS}xUPL3Mr_^[VhVjiUuD3fuPMlMEPSMi_^[Gut븋UNUUVI\NU;sP^]HUTSVWMu3M}M EԈHLuhIM lVEPM؊iV L EPM.hIMkWjEPEPtMhM(IVME}kWhEPEPZtMhVMykWEPEPEPsM}h}̍M2uEPM+uVh8IȬYYVhTI賬YY&Vh|I螬YY-VhI艬YYu;b0LEPMEPHL EPM=LL.GP3CSu\ jSju^ >3~+FVSjuطMQEPM*;|ՍMYgM:Mb_^[3xU;Q}BAM4 ]MhI72Uc3xw@xnEPPEh0HP(LuLE3fHf9$P8LE L3UVF 9Ft>jY!E HJHJ@ B NFF^] jX;s'W3jZF  Q譏~Yu ~_둋ՋFtPvWvUVuj΃t @PK^]jUSVWx3E}WtGEE33ft,E}PEEf9EtC_fu}u_^[AދEJF;rU脒VjPh1HP hTI"^UE@SV0W-FuXFHlxI;e+SMxF0,SWvM9M EPMsd_^3[3UhSVWMq3EEԉE؉E܉EEHMEI}Ep]u SjHY@Ef;E@Effx30ME3t"uԋ؋ UuG;ru ]E;EPM,SfxAuH}uBA3ɋ@fGEjH[f;Ë].f;Ef;E(GË}E@E@f;EAjH_f9x}jHY@f;CjYf9H]SuMmEEHEEEuEEEPL}MbM2MobE_^[}E"}jH[f;Ë],f;E,IxAjA;Bt2Ë PbUYuUS]VCW0*FpCHiXExv @HiMgn;QxM[+;[E@0)WSvM!M EPM[a_^3[USVuWt^M] ;YsStG3;Aw?τ͵VBYEwVXP7C 3f _^[] q+jj*GU}VtpSucY؋Ή^e΄tLF F@PW3jZF Q迃YFEPu6貃 [^]SXjjFI 39UEt ]jXUEV3Ƀf@jZF Q趉Y3ɉf^]Vj薉Yt F ^3UV~ t?jF cYt2E HJHJ@ B V^]uN/3U SVW3Eى0E}Jf;tzf;trf;tmJf;te3@3ҍ CBƒ10}Lt4tB"3_^[Ã6t*8t(}>=~}t3@똃}tE3FUQSVW}ډM3`I Ag======tf=t_=tX=tQ}tc=t;=t4UV^ݾԾ3_^[ËE @P鯾N3B 鑾u 鐾UQSVW}U3`I C|=====d=Y=N=C}t\=tU=tD=t=UV^0'3_^[ËE @Pu UVuFF(F^]UQVWuOZW 3`PDžpM]E}x] fB}U}M}jغ&KO &{j&KO "{Guu:%{.{={3Eԍ$}\4 u ^ ]{3j PEE؉E(P莏}3 ։EuuU}t%= {M,t;7{}G{[f{\Uf\uǃ  u f-8SSu(uU( M؃ȉM؋u}uE̋U}]-%;EUЃuUЋ]UUU؋U|]EU};nU},fBUuj (PRIoU }M U}?BU+EE؋EEpEOۉ]]EЃ`S]j}}(Sw@Tu MU :t`MЃuFwMЋE|EE؋EME_4% UF5U}4Mf2}U}f]~3uEċMu|uuuЋu؉uuuu;EEMG+k?T}]Ef;uZ I@7 .ؾ4ًM҇ɇEE}ʋUUtgUE։UMăB!MfQU}u}t f](U}}!M(E Ah]ME}`M,ۜE(@@Uf@@fB}EE(@XxXf2UUًBhz@Et#Džt33҃2&3Pu(lu PLP\PPE$PuEuUQu Pu4E(HX ],Ul\}f?)3t+΍C;fM,C]ƉMBxfB}U}E؃uEЋ]MEEE؋E|EU Mf}U}UUp]]؋]]]|]Љ]Dždj&L]MME}`nM؅"tSă](ff}UCT{Ufu3FbfU}](}f?\yfju ]]}ht%=@y}u\\y[yM ;E y yE(VSPopqrst}Wf;I+3u]]f;}f;ȋE }Mą}u؋}u(uf}P]U PwWV U U9]|EuuMfEċ}HEąJ},t~X~]FfEOj&KEԃ]}(jSw@Tu M[E 82tT}L ElMЉU[ `} oZ3zyӉUN}, Gy@@H@@}@@4GGFHSz@     US]VuM3W}UM=^t;^;w#+AȉM΃M F;vE_^[ø;vUVuWt9NBIf;t؍E_^]3US`IVW3ҍ AB};jw[>j3Y}uf;x@f;nf;`f;TAxf;7@f;-Azf;!@f;Asf;@f;Auf;@f;Aqf;@f;xAwf;lG=~@$V@3_^[ÍN" w錜3@I4@*'Hl'H&H'H;@&HN@x'H(H       |~vt}Åt`I AUVt-U t&1ERCPA t A3^]jj3ҋI@f9uU,SVWڋE!EajZjpXfMf;}fngfo]f;T;\][\TL`IjZjp4FXtAjp7XyfFf#jpf;X\Nf;}]tLj!Yf+ff(fEPEpJYYj!Yf;Lf#Bf%8f'.3ɉM؅PMQuӋG tl[-[HH[HH[HH[_^[Ã^`~EjaX;[f;y[~"Ef;v;Ef}jpXZFjZf;t jZf;EPEpIMɃMPMQuӋFtEw$@jjXfnjl33Ajkjmԍ@ԍ@@@ߍ@ߍ@@@VN =^=SV~$u3ۉ^$9^,u^,^0^4^8^^[v$=Yv,fYU$SU܋UV03A W~#3ۃEMUt%=XZutVGЃJw,GE{ EIM1HZۃ @`E ^`E0E܉8_^[ËދEUlSVWL$0x]C0.FD$CpFD$CpFd${D$9t$L$4\$S9L$4sL$$bD$ Pt$L$8t$$-M D$ PjHV@L$ M;L$0'_^3[]U}SV1Wt%=4j_j [;4;t 43_^[]34UVjdY~E HJHJ@ B VF ^]U\S]VCL$00WFD$C0FxCpFD$CpFWpL$. \$L$8\$$\$(*|$0D$,+8HD$D$4L$WfYT$ D$+L$+Pt$ R̅ 8T$ L$4+PSQL$D/D$8PL$Lt$D$LVPu D$L$H<D$L$ D$$AD$D$$;D$00L$8)8_^3[]D$xT$ nL$7ǍBUEt f9t Hu3]Ë]UVW39~t_^ËF HtJH,H'QQl$hJP{j0aYtlQL:~j lP6s UhSVW~$uV~L}3jPEEc} uEMCMC33ۉU]d$}]~$~N(;v0F@v, F8PRQ6N$ȃN4F,PF88;x}}UF,E+*N;;M؋C9EEM4VHPủ]IYẼ 3f uE;tCO G@9G8OPu̍HPX_O 3fHEPuEE;]tCO #G@9GhOPuHPX_O 3fHUM ډUBjjMq]$PEԋE̅t P&_E3ɺ Q^3f XEu ~8nF(+PSVMeEP~M4M4E_^[] E+KUSVL$WL$pˏ}G0G^pqFL$(D$83D$ @rGH`;c.D$ t$8HL$tD$J.SL$tz..k/0\$43D$I|$D$ D$Eu@PuSu usuM;E;C|%9Uw%=E&wC< C<0;E}VEu% ‰;suM 9MCK +‹UM+KxC LU EM;(PU E;C|1MԉE9Ut%=‹UJ%yHȀ@G MI G JJ;}I@;t ;shy}Z9UlfGf#}f;C|U+;ffNU}f;WUE;CK UEDEC+E E؋EԋEE+Cx$. EM@PuS`Iu GuЃP    _^[]ÍF|I IUȉME܅uEE؉}̃EԅMEu9uuҋU)}E@PuSu u!uIM;MxS|;} u*{uCPRS @M%=E؃ E@PuASu Mu׋|8\9tb 2(@$ @M}̃E|I IE؉MEEGf?>@ABC>@ABCRRRRRDEFGHIJKLMNOPQȫ@PHU][mULM3ɸSVWEE QeE3jEfSEu] 3K uЋ}}y3ɉ{fE@'Ku'K'K;byf:\y;Uyf:$zG};BQK EzC9C`zKUfHCK3fHF;{u؉u3E E3ɸE Q9D3jEEf$DEMEI;+׉Uz}M;v{} {uWDDEP8D]uuuDVD_^[]3uKAAA3EV`USVu مt W};{r_^[]u3s+B C ++ƍEP7APyP< )s7;CvUSVWًM 3hID$}u"GHf t$&4Gj0#9j8BYVE@0h v̒hL$ut$2D$υ( d$~)D$P D$@D$;|ߊD$u M D$PvEjH "tg,g0QL$_^3[]3/UQS]VW3~f| WU t"jh7SYYY_^[Y]2US]WtcUM ;JsXkZ+ًO V3F;EGPM PEHOPHP:_O 3fH^_[] Hj@YtL0G G@ÉGt@3jZG Q@O MQ7V2:7m3jXU(SVWfE33jdM؉}fEzM蓚] f9;${  {}ff}0ss.tsAa_ƃ$=DZ@@$@jOMMEP@G}BG\9w}@OE MtGD@E PEPEPEPS<f} JZEP}Z1u $3PMGM؉}4{fZv?farAfzw;ME@PM^M؋E@ftA3҉EfAGfAsf0f_t}}Muu`HEPMMEPf<{jMWMEPf}3MxM."_^[] zEPEPEPS}lMEP}f9?G}f<{=MЁjAOjNMMEP:G}YtN MQ6W26Q>_jXUSVj?FY3j0Zf;f;}'EfFf;~ftDf t8^[]f;}W>tG G 9W9Yj?Yj0Z_ĉ^UVFf0| f?u2jS8Yt,E HJHJ@ B ^]Qm3VN  f3f^Hj7Yt(jF X3jZF Q[1Y3UQSVW~ tuMu u`H~u^>tTw;u uEUtff; u4NuEE8uu7u7_^[]$u3ʋv 3Nx+M4Ex~]C;~3뚋uN;‹EFt61YF3jZ Q<1Y3ɉf xUQQEV@9Fr^=AzWPF#PF0>YtNAQ6W|*6S1>_UQQSVW}u Uj0XM Ef9JjE[BE."+u-~u/~A9* E tO B@QωM U륃EWeN߃A}pf}_uEt@7=QY3f}Jڸtw;|;ju>^_^[ZDJxt X]A3Ej9PYf;Er.f;w)PBˉ%Gٸtj%[Ea7tjAYf;9t jUYthu΃Uj5EEFLIL&u2uj 7AZY!$<xj9pj멋E 2jUQMSVWu} 3_CUf9 GsOf;tMP*3f9 G~sUf9TOt 3_^[Y]MPUSVW}] M4AfZvfarfzwVfAsf0f_t܋w7`HW؅xf u,ju_^[] !L7P؅x2jf,tf)tf tf=tf(tf]tftGrMj4}MWf9?XUQQVWO gWGj^9Gr#WfEfQGO3fH_^=ArWPG3ɉG Qk&?YtO MQ7V[&7E7U]0t!LSV@Wt$t!L05h3ۋÍ$D$D$D$#\$$8}h W$|h$L$ $4$>$$D$DPD$TP$D$Li"SVW$}|$`AU3!g$P$P$PD$@P$TD$4P$PC$P$PC$PHh b+YPL$H$~t$D|$|$#QV$D$@VD$D$ VVjwV\$&BYD$4~fDFjYf#PLY|$$@j$L$l$PD$ PD$pPVL$hD$4D$4u D$ VPωD$ |$"D$$|$$^~$$$H\$L$D}$Z$N$} t!L_^[]D$4f|F_3iu\$#D$D$W\$VF F 8u6*v *YY^UW}WtAYtVpx f wu 3fDw^_]NyUSVW}3ۋtuf?#tRf9t"t't4;t$uJ_^[]t uj^܅u43fڃtuFjhIWRL tjʃt2믃tU,SVWh (YPMt{uf>#tj[M{_^[jhIVK 1j hIVK aj hIVK ajhIVK aj hLIVK !bjhIVvK KbjhhIV^K tjhIVJK 3C]QMV tbEVVjhhIV K tXjhIVJ tDj hIVJ tjhIVJ uEHEy3CEiUV~ t6V^jF '}Y>xt.u(F^]}Nt uW3UVWu>xYFtKG3jZF Q%  ?QuP! j&tF _^]jX3U(SVWjYpJ}‹U HfuExƃfDEfKIyE3_ ^f C[u2UVW}3%BGM 0 M _3^UQV~ t`~ tZSWZ3ۃ~ Uuz|5r+;| %w\>zF _[^óUQQVF HtHt#H[~F1~RdFY^\$VVރy u u2ËAxwÃy u Af80t2@xuÃXuUED{u('KD{fSUVWH]uUmUEt&K]}+}MM +]E;|;s_^[33ÃUDSVWO V ‰uKH$@΋x+C_^[Ë Ί 3:[][ED{'3뿋 vOjV@3@2듐@5FG7@X@@@]FGFG@rFGFG@FGGGGGUSVuWFH߉}}}}~<~E~N~W~v FH \؃~v FHIuVuJu2uSW,P$Pxu ΋Y>_F ^3[UQQA {tHuHtHu #FHu*A-tJjUYERHCY3UQQEPEPu(LtIMLW8u6S] Cw.p@$T@juuSWJ3@[_ 333O@/@GFGbGGO@UEVW3F98u[F E=,E ~ 7tEDEDG_F ^]}tMS}tҍMEȋ0UыMVW|P;HBtt!LE S"L "LE!LE!LWEXJjj;0 tff;u Ou3 f;@xN~ER]M@UA_IJ "LJ "L[J^]ERtJ;" 8]ff;sBABzuUBE@J;8MEtff;EuvMEu;rlMAE@:Ettff;Et]f;@M?;Z]?2^]ff;sBABzvEIu3w*!L!LhG3USVW{] U BjYf9HtWeejEPSRE!^p~ uFt6YF3jZ Q5Y3ɉf xHMAFAFA F VW~ `e~u(~S_t7cWPY^F [_^F VW~ ~u/~S_0tO MOMWY^F [_^F UVuWtT~tv~uF~u~tWYF F 8u6v YYVY_^]vUQQEV@MQQ$hu ]MEF 3^UQQEV@MQQ$hu ]LEF 3^USVW}G3ɉL$L$ D$$D$@L$+t*H2-W^L$eL_^[]u W1x鞍Sك{ ug@t8u4V39p~W3Ih@]@yG.yG @ @h@ @ @ @@yGUSVW\$L=<lh@LƃH5HH=L>h=`LChjjjjD$`Pօ=LGhSp=LEh=Lht_=!LuVxx!LD$D$I\$d$D$J\$L!L9D$P=4L=`L3ɸD$XD$\ Q 3jD$Xf D$`$=TLh=4Lit$`ut$T V <=Liujm m6l-l$lllE@E;5!Lkk5L!LkF3ҹT$ T$(L$,8T$GEPVyt$(4T$ L$,DD$,D$ 5HYƃHH3_^[]>u9H+3ҁifw>|;G~vyHf@3u V)H~i@$@D$ PD$ PVjVYND$fxiD$KPD$$PD$$PVj;EËF F 8iVD$(|$TdD$PP(L:uD$PP(LBtjjjjD$`Pօ+붍D$PPHD$PPHvBtjH5L$H5Hjjj$Pօ;AlD$HG6.jA@j@P<@v $@3sv@@UG@7VGVG@@VG@VGVGVGWGWGVGUdSVWk2_^[]UQUSVWz3ًuuu R_^[]($d@u Q_^[]u R>_^[]EPRƃH_^[]jEPRK_^[]`_^[]u RD_^[]i`QRE BC_^[]u R_f_^[]u e_^[]u Qxh_^[]EPR7_^[]jEPR4K_^[]u Rd_^[]AP0o@G@@@E@@ @@T@B@GGGG@GG@G@'G[GlG@0@JG}GGp@f@@GΆG݆GGGGGG9GUS]VW{ME3׋ AfN@fO-fG,fHIfAt-fRt'fSt!fTtfUtfVtfn뛅uUA9YXA `\3}P]TEuEE8 L9 L8 LJ5 L>}!LE7"L "LE!LE!LIEH$tH;1Utff;u Ou3 f;@E}HQ;@UtIff;uMu];rs]AUBAyM]}AUB(E}H^A9E]tff;MuA;NFM@AM@A"LA "LA6Fv%EUut|֓F }t ttOAfxGϓ]IOfxNoGxf5F   ]CHx}fAlMjEPEPBSUEEE xo}eKEfxAE;t9~ f~F EPF "uEEE`_^[]sAUBAyM]}AE@= L!LEݑ"L "LE!LE!L$OБ;$Utff;uxNu3YE}GMA LM@A L"LA L "LA<5 L.Fv%Wf;@녋]U~ qEEEED3@ EufxN]DM@ BEjEPEPWU)}Ѓ]ċÅMUAfxOfBUE}LO؋CfxN]u~ ˒3ǀ~2d$~ u#@}L A;|jjV# uݓM̅nEЃt}]EEEOUfxNuUNEEED3@ E]fxNd$DM@ BEjEPEPVUu]ԋÅsMUAfxOBUEuLN؋CfxN]uu~ 3ǀ~:}I u#@}L A;|ҋ}ujjVB" M܅/E5]AwGEF9EU]tff;uMuF;r$s"MG LG= LHM]y LEx= L5_GE CME;HMtIff;u4NuE;Es%MG LG= LurۋM]y LEx= LC$ff;f;F F 8VE>fR/Ǯ$ @EP Jud$ff;tf;@Iu}Nu;VM 6v 3I3wWF' V$4@MB $`@G $@E] $@E~UF $@EY] $@E6U#E3/UAjjEPPP@]@[\3Uu鲎][3uM@GGGG@7@7@XG7@zGGGڏGڏGďG@@@ȎG@GGGCGCG.G@'@PG@@@@@GGL@J@ÉG@@L@@G@G@o@jG@@@@@GG@@G@@@@(G@6GU"LSVWL$}3jfD$`|$$D$(D$D$,fD$0l؃D$4}u UCB\$XD$T@ D$D$dsD$|$L$h@AL$@@A"LA "LA@t$lu L$PVuUE;tOrBft?3Ot0Xw",A$A't$d$L$]Ëk0 K|$$3D$(D$tsSpޅu_^[]t$$D$ "Lt> wG h "LG t$$D$Ft$$|$l= LE E@D$0q= L_= L5 L>C !LD$"L "LD$@!LD$h!L@JT$8D$`; T$0D$<td$ff;uL$ [wbG h "LG t$$T$E FEt$$@ND$HhF nD$HF u =D$05 L !LD$"L "LD$E ;'3Ʌ~& ;A;|EX3~F  $uBh ڋNuօE<t;U _^[]ËًH& -jKtWhIs U  _^[]Ë苤}d$w芤N3[]3_^3[]U4SVW}O W‹EAG  ] KO$0(A { 1{{ CpF G NN{{ { KC 3_^[] { Ǡ{Ơ3O F K;_UF SA{֡3NF ѡF {t{ g{ ՝C K3_^[]BNrRwEwG @ { 1{ Q G M K;CUG A{k3NF { UCx}3F u YG WN{{ s~t-N̛F қVF 3{C _{ Cx}>3F u (Y .N{8{ Us~tu V{C /3{ {{ CpN  >N {O ;@It ] EF k jϋ ;{3 { CpI =$p(AUH (A$(AG .>E Njʙ;E v;n>{ {3F qvG;"jjP{V{ >KqtQ芣sC "O ;Z ]Q EF H $(A{{K{13  ]EF H $(AUE ME ;E ח;ϗ/Cx)@7@pCx{ S Ѭ^{3 F 赡3_^[]@x{ Ct@plU z Na { ds荮Ћ' ˄RusF 3_^[]ØYT$ͫ˄ F 贠3_^[]H=$)A>ϋ5;购 8)A$()A蛭3S )X)A$D)Ani9/˄E u Ο_^3[]HH$d)A>mw} 1mOjV/mvmOjVQFQF蛭k-˄2E -{ C5H={ C2pI.묀{ CHCxH wl$)AGϋ觨TR|H )A$)A;&J/C@92;;/@ ;;Z @H ;2/U_UU;@H?@pM3WA Ao$A&A$A#AG&A%A"AAA: AA AG!A'A'AGG'A'A!A'AGG!AG$AA"A'A'AG'A'A"A'AG'Ah#AfG(A G(A(Ah#A(AGqGA%AGwAS&AwAwA3GwAA%AG%A׼G{ AG%ABGĺGAl!AHGhA'&AhAhAuGhAl!A'A'A'A6'A'A'A'A'AG'Ap'AiGh"AUQVu~ -MSWt?ǀ~1Ud$~ Ru>@} Iuփ~  ;3҅~$ ;B;|3ۅ~Hq UuoAݳ UB؉UOuϋup uQjt=u G6<_[^]ËƋu3^]3u 茱_[^]_[3^]U S]V[W}]SjW 3Ej@e KOKOC G ]VjEPS}E t!G G 8'W|EFEE;uq_^[] 3VW~uF }5_F ^ËG G 8t>WF F|˃ w$,A@_F ^7w 뮋w,A3,A3,ALG3,ALG MG#MGMMGMMG8MGUQ ƒu]Ãu ]E]Ãw;$@-AIuf80t P]PxP XuF ]çMG:-A-A:-A:-AMG:-AMGMGU|SVu 3ۋHW}EGщ]؉]E]ȉ]EHUfy3EEEEEE]ETF E EEAEAEA EE3E8 LuT9 Lo8 L LPEEPV'EX@]UEEE]G@fxNEM G]fx*FjEPAE PM MWc+E;t{ 3EP(GM fxI8IjEPAE PM MWMEPMOE fxGMEE{ 9Et"ttM莗MCy}GOE fxG32ҋH;!L?~;L!Lt0u,@fxuҋ HuątY]벍Mh]rG{ sGEiH`HMU]؍MET%HӍMBGE]iGj8NEMMOMO OE_PAPO EPA=MdG0d`CuGM MMM_^[]MjjEPEPEE莥jEPEPEPפ]]3OBG<}P=EEPEP L3]j&jDE@YI3US] VuWD$PC|$\D$4H L$D̉BABAB A 8ɊD$,]L$CD$`D$hD$lD$PPIfxGD$TD$XD$\D$tLID$xD$|DŽ$D$8]D$PD$PVL$ L$(SXL\$,CC;!LL!LD$@fyu 9++]{T$L$D$ D$06D$ ;Cta;Cka;caCD$DD$H_D$DP Lt$DL$H萪{D$ LDŽ$XDŽ${ DŽ$Ƅ$DŽ$Ƅ$DŽ$DŽ$DŽ$Ƅ$_j@~$PFN $FFFPAkF0CF8sCD$,`@`@L$0PD$0;.HD9πy xE`y __Yu;t~ V_SpD>~ xB_~ Fx0B_p~ N_~ ^C8D$DtK jcS蛿D$HFF NHD9πy f$Py AW@p~ ^N$P 膦~ F* L@0蝧$$L3$L$`39|$|vt$x־D$X39t$XP轾_^[]L$TD$x\$+D$4L$8D$7I0E;t5v3~}؍G9E}P6u} 3= LuuXE95 L = L35 LVEP远WMAq%EuuE]6L3EEt"PEPEPt Ea5EXU53E CfxN}}u SfxA}AH M5}}Y3MRjEhIxFG3ɉF QR ?QhIPI j詶v}F učE;t 2EPMЋE 0CfxN I3҉U;sC Af3t5fNt,fOtfGt fHtf@tRftPJUF;srBB Q;UtU뼋 }ԉMt3f f;uMMJuX3u}ujEPu S3E L;t}EP} S@ft%f@3Afx3CUuԋ] uV藵S莵MEM=_^[] }2hIM趍uEjPEPԖuEPEPEPEE}3P*E܋Eԅt PE3ɺ Qq3ɉEf x/r/EPEP L2LjEPEPEP}}E~1EPEP L/UU C uEfxNx d$ CfxOx {/jEPRSؼpU C fxOZ}@PAM;MMU CAM fxNoMj}Mw39u~!d$MxF;u|ju9~0}T. 0uċO,2j萓.U u|/E~3}jPWRS3|E3҉UH33Wj{/0W$0Wj~0Qj~0u0U USVuW:vً fxG]4+G:3ۉ} @G|GMHt7"+Aօ'];} FG EEE9GjA؃EPCXOGVGOGtMEPuB*]M;t5UBfx@*A;*ME9uLM}ue3_^[]s3ɉG  Qu؋G*_AKAC3SW_^3[]UQQSVC WG KHt.HH']]At3_^[xϋo3;3@UQQSVC Wu>j^;t]Es MmK_^[Ht HHt݋u~ u(UM;u;u jY9N dC ;sU,SVW} ًMGD$PID$D$ D$$0@ D$"Lt$h;5"L'D$ PQWD$$PuV|$ ;x'Vz;x'uF HDˀy @y A@x 4'wN 1F,F  Gt$@0PHp uD$P օ33D$PI9t$ v-D$ FlKpKtKxKK( KKT FKKKKK< KK FKKKKKL KKkEKKKKKX KKtFKKKKKx KKΈE K$K(K,K4K K@K-EDKHKLKPKXK KdK !FhKlKpKtK|K KK$!FKKKKK KK!FKKKKK KK@KKKKKIKAKKKK K KKlEK K$K(K0K K_F 3^]UQQ}.4 Ltr}34LSV03ۋW}CE]04} tM O~L}5E jPFLN Eu)E u&~84_^[3vL *FP҉FTV~ Ё щ^USVW}ewM]]]]]ivGH*Ev GH*؃vOI*EvOI *EvOI*EvOI*EO1YuNuSuuuu1&ظu ܃>_F ^3[U(SVWhLY?' L}M9 HL41EPL}ΡL]8LpuʀE @#E E@0EE E E }}u-jEPjj0(Hj8HM+MM+ȋ+E } uFjEPjj0(Hj8HM+MM+ȋ+E @tj8HjYE uEujjPHuEjSPHE+Ej5|Lju$PE+EPu u Suh&KuH/VjPHE$GE GYt u>USj cc>YtVuW_^[]3UQQSVW}E7PHElEpEPVTHME;tua;xuYs5HsEE;|(} t|;/)} t_^[} tx|(UMtW} '_]Uu(L)PjjjudH]U졈LS]VW8jW@! LjZU;L0F;G X!O!! VW8~dH!~hP!~DX!~P`!>t 6$H&u(L} LUBU;V 6!$:!Lt QL385HLN5HL;Lu L L u5LLWH=LL LtLD98u L_^[]UEV@WP(Lu ΋4s>_F 3^]UdD$SVuWPD$ PV#K`D$StL$D$ L$8|$$D$ HHH6WQv7$Ht$Du/du4hu9Pu>D$ ;Ft@P3@_^[]wDHwdHwh$HwP$H뷋L$NUVW}ΉMt^\;u>V;E Yt[jj7@H_^]uΉMt9t΋6USVW}ߋFttQ]Ft ;u*|Ntˋ8u O}NpU~xvNxFtD8t_^[]V VH:Y^VNppNTN$N^VNVF4 :FYN^$V V9Y^Vh7@jjZ]NlN(^SV3Wj_N(FF ~FF^F F$(3NlfF8F:FM}]~ u]4MG;|u }3SSu[ thMQMGfx@uEDB;W#GjOZf9PuA3ۉCM l_^[@ Pjkujz٭U tES ]3UVuW~ F} t!~S] s[Ou[3 @9 ~9Ⱥ I   AAyqG; |Ӌ3ɋ@ Q3j3ȃt<H39A~ @D;A|_^]_2^]3V~ u ^:Uy u'V@}E ^]22V~ t7cjh#3Y3ɉHH F ^UEU SXVW3ɋ:4FGt1Ht/t6u t @tGԃ>t>&3_^[]AIx̃>*ɋUSV3W}wPE;TYtuQTYtFwftf_CF3f__^[]UVW}374XK&SYYt F-|_^]UVWF 9Ft2j1YJbugTNF>+‹S豁0uOYYx~ {M;~;_^[sUVW39~tUF f98t?jI.YN A F F M x ;N _N EAN EAF^] P.NYj-FF VWWE3j@Z Q-WVF_^Ãy Vu'AhI0VRYYuhJVRYYu2^ð^UQS3V3@WhL(L,L0L4L8L@LDLHLLL=PLTLXL\L`L/j^j|Xf<L3L&KLLL=LLLILLL5LLLLL=L=LLLL=Lf>L V]EPL| Nu_^(L[Uu uj]ULESL$$M Vq3!\$!\$43Wt$B3t$ t$(t$$t$t$t$0T$<wcA$/AދD$S;S;S;vE H I D$ D$S;vE H , D$K;vE @  D$$D$K;vE HLD$(̍D$@aPvM\$$Wt$,t$4t$t Wj6HM,__^[4EvsPWsTWeGGG G'GEGGGG GGGcGG0GsGGGGGYGwG,A4GGGG;GAcGGU8SVuW~:k] EEP6HMԋE؋VD~HME U},;EEP3|HM̋EԋU+EE+ЉEEP6UMTH}E}uMfE} fEE}fEE} fft(EfuE+;t'Ef`uE +;U @_^[ } fFXffF\ft[fF`ffFdfEP7H9^Xt99^\tAEP7|H9^`p9^dyuk}tfEffEfUQ LVW9 Luh=Lh%Yt~EPL}5LF5L LL Ɖ9MIO_^j^3;~ L98u#ha%Yt뮃3F;|SV3WN~^^ ^.N$&NT^4^8^<^@^D~H~L^P^d^h^p^xF|fffff_Ɔ^[U,LMEtAXE tA\E~A`E~Ad]UM$uE(@S]#E(VW} jQuWSuuQhIhxKPuu ENLfEh fff#U3x xYp8t99u1f _^[]$JO2ߋ UME PuaSVW}3S5|Lu,7u(u$u uQuuPHt$8]4tSjHPj0VpH9_^[]0%USVjF [9Ft*S"YM NFF^[] jX;s(3ɉF W Q"~Y~_뤋UQQEPjh JDJ f}1UQQ}SVtputi3fEPj3SRQ HuOE W<EPVSSu}u(HuEE;E s3f Fu$H_^[3fD72yuÀy A@t@UQQV~ tY]XEF ^Uu Ep0q1]U}Wo}uuu ujuhDHt_]h 3UV~uuF^]~ u)Wj!Yt+ug!CFG~_uNF 3VVBYt VBYu3^3@^Ãyt y AuËË@U@SVWjwىUYEEEE} vjf;;;0 xu3_^[Ã{ uEPv-YY]tԋUnGUu+Ћ3 _  }wE;F+ȍr #IO;r}3@;;n-Kf;EjwZA Af9tuUWuu `ICUjwY]ȋ nw-uE;tuG+3@2u u},]} Cf(4f;+f-!f#f$f; f+3@Gƒ!Q.;QHQjZUu;6R ^_^[]Ãtl RfpQV  wA$AG+O뤃~VjZ;3Q~uAt%=3ROO `3jZ)3BKARA*Hfaw jUXf;QuË tQQAf?~2f0|U\SVWM3hMfȑE30V4K<YYtCa|uaM`w$AM PؑM_^[hIM ϋu ^R>F h,BKh8Kh0BKj&Fj+?j8j#1j*j.#jjjjjjjjjj *hBK?!L 3AjjP G9GYG٬G9GhGGɭGGuGGAAAAAA AAA!A(A/A6A=ADAKA-GJGgGGAȮGݮGGGGGӯGݮG1GFG[GpGpGGGGGARAAG/G]AGsGgAGFGFGGıGܱG:GtAUG|AAAAAhGGGG]GGA@GGGGGijGڳGGGAA GAGpGApGGUVOEF ^]VWHȿ+3;v;v;w_^UQVW}3M97tA`t,mW3Ht3@[_^3MF;ur3V~ u6&YF ^UutPM @]3UVVut^]3A Ht;Ht.H:pHtt HHp39ËAxp Ap9oVj sY6A5!L!L^Vj8NYtQ!L!L^3U\SVs PC4DžHCCPIQh8IC3jfS/SS S$S(fS,S.YsFHu:CKKE;EFK'K%K!K)8MEK(MUUt#eEPDHPMЃ}uC05HWj3Y3}ĉU_8C0tNMUUEPt0MЃ}tuփ}fEfC2tu^[HҍEPHѡLuh:GL/YLVtF^øCD^V 39F^V~u h$.KHth.KPHF^VQ΃u Pj^PUQSVWy3u _^[ EVtF^øC^V 39F^V~u h$.KHth.KPHF^U=LVtIu3S38`LtM9uE3}tMEP(Lu&EP(LuEPHEPHjSSSEPHuƆdž=LuLLdžLu3@  [^UVuW~FH:'KQQ$tF]YYcK&KF1HKMQQ&K$hu} YY]sJEG ~#_3^3zUx!Ett؅x]]UQQEV@JQQ$Nu ]IEF 3^UQ(3]UEVWPHEm@]E]BJm]$}u ]wIEF _3^!Lt!LÃ!L!LUEVPHtm]E5 'K^U,LeSVW3ۋCh JM؉E]jSEPEPM5LMHh4JM؉]ujSEPEPdM0LuQčM dE|vM艟XH_^[UQQVW uQčM )Eov_^UQQSVu Wډ}Uȅ_^[UQQSVWftvj^uEfufptv;DtrU|$ZD]vD`DadD`I AtB7vfu3_^[fAf#ºf;uۃA AA A뮋_3ɄUEV@W0QiH u Y΋G>_F 3^]UA,uA,u] ]v]#uUSVMu EPT[uEP]M^[ULSVWhVECYPAYYj ϋ\Mc莭EPwtuhlJV4E }En\M'}VFYj\SV CYP4AYY_^[VjXfPFY^US]W{3PPPPGW3PPHEt7VPaY3PPuVW3PPHHPQM VVY^_[]M UVW}t=t8}t2 ΄VW&Wu~6 _^] QQrUVW}W2u(GP6>Ft6Yv Y8_^]UE@9A@]UEt ]jXUEVWPHu ΅m]qDEF _3^ L*8L HL3LLLLLLLLLLXL4LLLLLLLLL0LLLUSVW} MAj3ZCf9P,LH_^[UVW}GgHGjΉdž_3^] !LtQVN &VG Y^ L!5 L L35 L L#ËIuV: !LtQ^LU+VPh HPˀ^SV3ۍNL^^^ FI^$^[3 L L L L L Lf L L LáLtP$HHL)8L LUSVuWj3ۃ~_w~wSWu ΋A>_F ^3[]U} W(L LLSV03ɋ8N:tN:99}ttcttPtB~'0~8uUWSHt tSAF83@^[_]3]F8F8IQSHF83U SVH];O3@^[UVu 6ui^]UM SVWhHjPDžD! e}3C=Lt5=LHLDžPVP~ gP8tSWHjhSWH_^[ ƆEPSVWV_ Y;32_^[V~ tCWjYt6V JOBGB G ?~F _^3LuVj7UQQEV@ @QQ$CUu ]C?EF 3^VNPSM[YYt1PK2LuKKQK2LE3_^[UuYH]UVMF ufjЉVJlJhN; Kt\KBpuraF;KtN\KApudFNApuApF  AF^]U=LuuUuOlF^]ËM tSVWjA_jZ+[ f;r f;w f;r f;w ftf;t_^+[]ju u ]UMSVu]tu uk]EWuBjAYjZ+Z3f;r f;w f;r f;w ft:f;t3MQPYMQP[Fvftf;t+_}^[tMapUQEPhHjLHthHuHtuUuYuHHU_pupYhjjj@ jjj1 U=\Hth\HrYt u\HYbshHhHYYuPVWh|B*Y`HH tЃ;r=2L_^th2LrYt jjj2L3]Ujju ]VjKVV[V.sV5sVIsV s^lUVu tЃ;u r^]UVu3utу;u r^]j=jYjkYjhjKWjjYe=LLEL} 52L5K֋؉]ԅtt52L֋]}}܃};rWjK9t;rG7֋jK52L5K։E52L֋M9Mu9EtMى]ԉEhHhHYYhHhHYYE }u)LjjYui}tjojYWUjju ]UVjhY54LKuKj4L$jY^]U54LKtuYt3@]3]UE4L]UMttgY]á0 L 0 L]UQQ}VUU MWtj-Xfكڋ}u SjWRQsMȋE] vW0fwru΋} 3f[fff;r_^ UU3 u9E  |9Es3@MPu uLE]U} EVu yjj juu VP^]U}MSVu Wt j-Xfj[3uȍBW wB0fu3f+fff+;r_^[]UU VuW:+u+ft: +t_^y~3A]U]Uj juw ]Uj jut ]Uu MEMH%}tMapUjuYY]UhuhwYY]U츀f9E]UjuEwYY]Uju4wYY]Uhu wYY]UEu]ËM UVHt2ft f;1u +^]U SW3j3Y}]9E udVlEtVEEEPSu EPEBE'xMxMMAMEPSvYYMMx EPSvYY^_[̋L$t$tNu$$~Ѓ3ƒtAt2t$tt͍AL$+ÍAL$+ÍAL$+ÍAL$+UQ=LW}3UucUtM tSVjA[jZ^+щujZ^ f;r f;w f;r f;Ew Ot ftf;t^+[juu u_USV3W9u]ubT} tuME9uQMjAZjZ^+߉ujZ^;f;r f;w f;r f;Ew ItDft?f;t8EPPkEPP[M[t ftf;t+}tMap_^[SQQUkl$(VW{ 3Mf;uC\TL%j^=wo)jfZfsf3f;tJuMS%=wdo f:c vMf:c JK %M=wE%=w7oof:c q?xDM3f;f;ttef9Etf9urYKfnpjfpf^%=w,o fofufuffuE A3f;f;uvы%=wK%=w=oofofufufofuffuEef9Etf9u돋{ 3gSftZeȋ+jE^ft'f 8+ȋEMu f9 8uMf9{  Efu3_^][U}t-uj54 LlHuVM_HPR_Y^]Uu M9Myt~EPju E A}tE`pU=LuM(KH]juYY]j hjKdM39Eu^Pc0 Pj0YYe~0 PIjYE Pjud0 Pq}Q0 PViE MË}(0 Pj0YYUE#PuE#PEu#PE uPu u$]USVW}3ۅt M u9]tU3CE$c9]t9]u9]u9]t܋Uu9] u9] t9]$u9](u9](t3@f9tHuf>:u t}rjWjQ~U~ t3fˋftWf/tf\t f.uNfu܉Mt,Et!+9EPWju*~M Et3ftE;rAUt+9E v\PWjR}UE$tA+9u(v?VSjP})Ut+9u vVWjR}E$t3f3iE$3ۋM t }v3f1Mt }v3f1t } v3f t }(v3f[uj^0M uj"Y_^[]UjuYY]U,K3ʼnEVu uMu[M(jPmYYuEPEVP}@ }^tE܃`pM3IUuju u]U SW3j3Y}]9E u[MmEtVuEuEu EPEBEtnMxMMAMEPSmYYMMx EPSlYY^_[US]W3u|ZsL3sVhjGYYtIRXplVXENFXEYY^TuEPuVh"Bu u8HuHVYtWYY3^_[]j hjKHWepXPTP MEQPHYYËeuUVWttV[WYuPH̃=<Lu9hHhjhHdHPHuPK8L<Lj58LK@UVUP[Yu,uVUP[YYu HPPHtHMQATFTAXFXAFdU[t 7̃=DLu8hHhjhHdHPHt$PK@LDL5@LKUMVW}t3U +:fftIutIt3Ћ f_^]SQQUkl$KfS =TL|Hfnpfp%=w>offufuffu4f;t fu3f9H#"f;tftE3][UESVWft*} ftf;tfufu3_^[]UV3=TL}-MffufE ;tf9uf9uk3gUfM f;uftMBu3f;ufnof:cuJfno f:cAs4Jt^]W|$n$L$Wtt=u~Ѓ3ƒtAt#ttt͍y yyyL$ ttfu~Ѓ3‹tt4t'ttljD$_fD$G_fD$_ÈD$_UQ|SMEuHSV3W} ft0ftf;t 0fu3f9t fu3f9tA3ҋft9}} f;Ut fu3f9u f9u3fE_H+#^[UMuTFjX]á@ L3]jhkKOC} @t0t(t ttmTuuUT ;5<"LsyE ރ@ LDtXVYeE @ LDt WVNYYS }E !u}VBYS EBUSVuW<@ LL7%ED7$ЋE =@tY=tI=t*=t#=uPɀL7 @ LD1$$ D1$4ɀL7 @ LD1$$ L7ɀL7@ Ld0$}_^[u]ҁ@]UEuRD]Ë@]UQQM SVWt]tuuRD3_^[Ã}t3;w؋F tNMV t6FEt,;sÉ]Pu6E)F +E];r^tVtYMÅt 3+‰E]PuVYP tQM;wU+;r=M(EVPcYYt(ENKM3AM-EN +3u j h(kK@} t$}t3uu5Q,C3@V*#YeVuu uQ}E ȋu}Va#Yj hHkK?3ۉ]3}uPB39E t܉}W"Y!]G @uqWYЃtt@ LЭK@$u)tt@ LЭKB$t,P#B]u%W[EPSu W`؉]WV[E>Ë]}WO"YUVuu VY/V,YtF @tVPhYY3^]USVu3ۋF $<uBF t9W>+~~.WvVYP覂 ;uF yF N _Nf^[]jWYj hhkK=uu V<Y%V !YeV Y}E=Ëu}VG!YjhkKn=3}!}jOY!}3]u;5"L"Lt]@ tWPV YYE"L@ t0uPYtG}u@ tPnYu E܃e F녋]}uࡼ"L4V YYEtE<Ë]}j0PYUf9EVu Mu싆uMAfwf jf9Us*u_YYu EMMQjMQRP u EE}^tMapUjuAYY]UMSWu ];s`Myt~EPjSmM Xt} tE`p}tMapExt~-EMQPYYtEjE]EYgL*3Ɉ]EAEjpUjRQMQWEP$u8E{E`pou}Et%MapUE Ѐ}tMap_[U=LuMAw ]juYY]UfMff#f;u-EQQ$蠘YYHtHt Ht3@]jjX]ø]ɁfuE u}tɃᐍ]EDz ɃA@]Ɂ]UQQVW]Wh?ڟYYM#f;ugEQQ$YYHtIHt8EVHt &K\$$jjEHQQ$jؚ7WVrE'WVdEE %EEWVEGEYY_^̃=8"L\$D$%=u<$f$ffd$uZ麟=8"Lt2\$D$%=u<$f$ffd$ue$T$D$ ÍT$ P<$f<$tԮT$L$Su=8 L hKD=8 L hKޭZÍT$xD$uA3D$u33% D$uÍT$;D$ %=u T$uutQ$\$q譯YatEBD$ % D$؋D$% D$t=fl$D$t-(Itڭѭ-(Iٱu `KٛuUQQEPTHMEj*h!NbPQ|=o@vЋMtQUj@u u ]j hkK63ɉM3}u @ Ljt,t(S@ L;t(;T,jRhR4HmjSD T;Ft3O;s*< uB;sA8 u PKAuэ+1U @ LDt*K;΋s8 uG@;ruC u>C {u3+ss @ LDjj# ;uC08 uF@;rC UjQ yW;wC t C ts@ LDtFu+΀u_^M3[hj h0lKO,3uu=/%VYeVgY}EG,Ëu}VYUS]V3u.=%/hWhj*YYt=;plW;EYYWjWh?Bu _TVGX8Hwu"HWUYtV<Y_^[]VXHtҋj hPlKH+:epXPTY MEQPgYYËeuzVr:t~t v HV :YjPHU8P>Yu!u8P>YYu(HPPHMQATBTAXBXABw8>̃=8"Ltn\$D$%=u<$f$ffd$uA}=8"Lt<\$D$%=u<$f$ffd$u)(I(Ĩ=8"L\$D$%=u<$f$ffd$uU)=8"Lt2\$D$%=u<$f$ffd$uռ $r ÍT$R<$tLD$ f<$t-)It^uA=8 L< pK9uԩu|$u%t-(I"舟uŃ|$u-(I=8 LП pKٞZÃ=8"L\$D$%=u<$f$ffd$uUI=8"Lt2\$D$%=u<$f$ffd$u $" ÍT$͞R<$t6f<$t-)I=8 L Ky&u|$u-(It뻸=8 L K违Z̃=8"L\$D$%=u<$f$ffd$uU=8"Lt2\$D$%=u<$f$ffd$uſ $ ÍT$譝R<$tmf<$ti=?s-=8 LΝ K˝w8D$ % D$u't"u|$u-(I=8 Lj KsZ̃=8"L\$D$%=u<$f$ffd$uU)=8"Lt2\$D$%=u<$f$ffd$u $貜 ÍT$]R<$tmf<$t=?s+=8 L K}w:D$ % D$u)-(Itқu|$u-(I=8 L K#Z̃=8"L\$D$%=u<$f$ffd$uUY=8"Lt2\$D$%=u<$f$ffd$u $b ÍT$ R<$tTf<$t-)Iz؃=8 L: K7-)Iz蛚u|$u-(I=8 L KZ̃=8"L\$D$%=u<$f$ffd$uU=8"Lt2\$D$%=u<$f$ffd$u5 $2 ÍT$ݙR<$tPf<$t-)Iz=8 L  K -)Izou|$u-(I=8 L KZ̃=8"L\$D$%=u<$f$ffd$uU =8"Lt2\$D$%=u<$f$ffd$u $ ÍT$識R<$tPf<$t-)Iz=8 Lܘ РK٘-)Iz?u|$u-(I=8 L РK萗Z̺ H顲 Hz̃ $ ÍT$ȗR<$D$ tQf<$t耗u=8 L Ku,u%|$uU"u|$u%t-(I=8 L K蟖Z̃=8"L\$D$%=u<$f$ffd$~D$f(Hf(f(fs4f~fTHffʩuL=|}f=2 fL$D$f.{$T$ ԃT$T$$D$~D$ff(f= |!=2 fTpH\fL$D$fHfVHfTHf\$D$̃=8"LV\$D$%=u<$f$ffd$%~D$f(Hf(f(fs4f~fTHffʩtL= |}f=2  fL$D$f.{$T$ ԃT$T$$D$~D$ff(f=|%=2fTHXfL$D$HfHfTHf\$D$UE3+]U SW3j3Y}]9EuC/:!E Vutu/!uEBuu=?v EEEPSuEP{Bt9MxEE@EEPSAEYYMx EPS@YY^_[á"LVj^u;}ƣ"LjPYY"LujV5"LYY"LujX^3ҹK  RpK}"L3^=Lt5"L%"LYøKUVuK;r"PKw+P.N Y F P@H^]UE}P.E YH ]ËE P@H]UEK;r=PKw` +P/Y]à PPH]UME }` APu/Y]à PPH]U} Eu yjj juuu P]UM Vu,j^0}SWw ,j^U3f@9Ew ,j"ދEj"^;w3ҋUEtj-Xf3@yEڋMߋ3uUЋE vW0fAt;Mr;MM r3f2,0- 3ffff ;r3_[^]USV3W}]]]u+j^0_^[j$hWu t9^|9s +j^0jX9F| >o@wEPYEPYEPY^|nvdE+ȍEPWM]YYK9E<WdY-E)EEPUWYYG VWYY9Et-WYt"EEG ȋ+։U؋E+jjj YufVW$}]WSu3Vu97j YufWSEHxQ LuEufEHx-(uEuBE@x  %3_^[]ÃpHHt[Huu3ju M}]39q 4E 73PnM M3@+E@du uujjdY} uuuutjjE@ u uujE@uu  EL MP 3@VVVVVUV39utuuuV NME ;sBHSXW}t* EE }E0fEFIKuߋM6)1_[1^]UM V1W}?v#S]Ùj [؍B0f~?w[1fff ;r_^]UM9t!UVu W:ftf8 u_^]U0K3ʼnEEUMEЋEEES] VE؋3WUԉM+tHt\XT)۸lfBVfEfBf@fEfB fEfBfEfBfEffE3VWfEEPV`tvEE=wuPYututouEVWPEj`tLЃJ~#]؋u;vff JuVY3@e_^[M3L7ft]؃;tۃe3ɋփA;t]]؃dj'X;AtHtPMtahHW-YYuJ ^ItItItIjBjbEjmItIt qEjH~hHWҴYYu}jpaujYujY,e"NyjY\H"LPLyj虲Yyj 舲Yj躲YtPuYVPjh@u܅uVx.MEQPqHYYËeuu܃}uV9E U= Lud"u"hձYY]jWVt$L$|$ ;v;h%XLs3Ʃu%pK%XLs vs~vftcfoNvfo^0foF fon0v00fof: ffof: fGfof: fo 0}v foNvIfo^0foF fon0v00fof:ffof:fGfof:fo 0}vVfoNvfo^0foF fon0v00fof:ffof:fGfof:fo 0}v|ovfs vs~vfbBur*$bBǺr $aB$bB$LbBaBbB,bB#ъFGFGr$bBI#ъFGr$bB#ъr$bBIbBbBbBbBbB|bBtbBlbBDDDDDDDDDDDDDD$bBbBbBbBbBD$ ^_ÐD$ ^_ÐFGD$ ^_ÍIFGFGD$ ^_Ðt1|9u$r $TdB$dBIǺr +$XcB$TdBhcBcBcBF#шGr$TdBIF#шGFGr$TdBF#шGFGFGV$TdBIdBdBdB dB(dB0dB8dBKdBDDDDDDDDD D DDDD$TdBddBldB|dBdBD$ ^_ÐFGD$ ^_ÍIFGFGD$ ^_ÐFGFGFGD$ ^_Í$Wƃуte$fofoNfoV fo^0ffOfW f_0fof@fonPfov`fo~pfg@foPfw`fpJutOtfofvJut*t vIuȃtFGIuX^_Í$̺++Q‹ȃt FGIut vHuYU%TLS3C pKj +3ɋÉTLV5pKW}_OW E5pKtTL5pKEtTL5pKj3Xu^NV E5XLt 5XL33}_OW }Genuu_}ineIuV}nteluM3@3_OW E%?=t#=`t=pt=Pt=`t=pu 5XL_^3[UE HAA]UVuf HF^] HUVW};tt w5GF_^]UV HREtVȍY^]U}St-WuxWYYCtuWPC C_[]V~t v谴YfF^ËAu(HUE VWjYYuKtVOY^3_]Ã=2LujPY2L3UE-t&t tHt3]ápH]álH]áhH]ádH]UMj E%|Lu|LpH,u|LlHuE|L@}tMapUS]VWh3sWVۚ3ȉ{{ { K +7FIu9AJu_^[]U K3ʼnESVuWPvtH3ۿÈ@;rƅ Q ;s Ƅ @;vuSvPWPjSSvWPWPWS_T@SvWPWPhS7T$MtL tL A;rWjX+‹ˉ‰ w LA w L AA;rM_^3[2j hlKb \KOptltwhuj לYyj `Yewhu;5Kt6tV0HuKtV٧YKGh5KuV4HE뎋uj c YjhlK؉]=shuYE;Fnh Y؅[Eph33SuGYY} Eph0HEuHhKt Q YEXhS4HE@p\Kj 4YuChLClLdLΉM}fDK fMpLAΉM} DKAu}KF5K0HuK=KtPMYKS4HE1}j Y#uKtSY{3aU K3ʼnESVuu -Y]uVY3W3ωM9KA0M=rPhHEPStHhFWP^3C 9]vO}Et!PtLA;v8uߍF@Iuv^~3ȋ ~ 9=|Lt VhFWP_U k0KE8t5At+sKDAC;v9u΋EGEr]S^FWjN K_ffRIOuVj Y}E FluKFlvl/YE3Guj Yj Yuc3hxBYKtVhjYYt-V5K6YYtjVYYtHN3@^3^áKtP KYNFu$Kà UVMQ Y0^]u KÃUM3; ŸKt'@-rAwj X]ÍDjY;#]ËżK]jh@mKRK95Kt*j rYeVhKYYKE[j YVW$jK$jK tЃ;r_^VW,jK,jK tЃ;r_^UVut~u6HHK|_^jh`mK8=4 Lu,jh螓YY}h6,HK|3_@^UE4hKPH]U@"L3Ktu]]%HUD"L3Kut]H]UH"L3Kut]H]UL"L3Ku ut]H]UDEPHEtEj XUQV5Ky%"L33Kut VMQЃzuF5K3^VWhHH5HhHW3KhHW@"L3KhHWD"L3KhHWH"L3KhHWL"L3KhHWP"L3KhHWT"L3KhHWX"L3Kh(HW\"L3KhjWYYuEf-uf+u>EEu6W蛲Yt E LjxYf;tjXYf;t E0jXEu%W`YujxYf;tjXYf;u~3uUEW-YuHjAXf;wfZv&jGYf;vE} u_tu3jYGf;w ɋME;sʋ}E;ru;Uv} Et>muu@ȃtw u-v%@"Etj[Át7t_^[Ujuu u]U4MuEM tSV3WtEt|$~hjSU}]qYYt>jW}|YYu}]Ef-uf+u ]EE$u0S^Ytj XEMjxYf;t jXYf;tjjXEu+S)YujxYf;tjXYf;u ^]EQPjjE܉M:]]MEUSۯYȉEuWjAXf;wfZv2jCYf;v*E]Mtu 3ҋ‹jYCf;w HɉM]E;Ms];}r/Uw;r&;u;}u3;Urw;MvM]tWPuuѰEjEX.u3ue˃twr3;w3҅uAr9wv2"t"t 3ҋ¿EE3ҋMt1tEtM 3ɋ}tMԃap_^[U=Ljuu uuhPKj ]UQfEf;u3ùf;sȡpKHEPjEPjH#EM #UVu WVšYN u N @t q"S3t^t}FN F F ^ u*; ;t /@;u WYuV%YF tzVBF+HM F~QRW6 G N httϋǃ @ LЭKA tjSSWg#ƒt%NE3@PE EPW ;] t N E[_^]UK3ʼnEESVu W}u3؍9u*8t `p t3ɋщf DžXDždDžiDžo jXA_f;wH3H) $B3؉ j Y+tFt9t/HHt   ˀj*Xf;u/x ؉b k ȉ: 3- j*Xf;u+ k ȉItWhtHjlY;twf9uj X 6u#f4uǃ~3u#f2uǃVf; f;f;uxf;3PDžQ= d+S't}AtHHtXHHtHHj XDž@Dž0j X ؉0u j X ؉tv u5K3ɋƋщQP裁YYt@@B;|XHHHHjDž tD3PptPP跪yDžf3ҍBt6pt/t+‹Dž3ɉ5KV YpegjiY;tfnt'joY;_Džy[M7C tfDž@Dž u ujgXf;uVDžJ;~‰=~7]WYt DžxG|PPxVP5KKЋt!uPV5KKYYjgXf9uuPV5KKYY>-F DžjsyHHj'XDžxj0YQffDžU t@tGG@t Gȋ3O3@t;|;s߁uy3B~ uJ t=RPWQ09~N밋+FtEt>0t*uPWj?>E ʃ>uE[_^]hH3Ʌ4 LUMSuQr]C=wE苀XnEMQPSyYYtEjE]EY 3Ɉ]EAEjpEPQEPEjP辙u8EtE`p3E#E }tMap[UUMVu u 9M u&33tE tu3fuu3faj^0Y^]SWًu+f3vft%Ou +f[ftOtJuu3f_[{uE 3jPfTAX3fj"U$K3ʼnEEM SVWE܋EP3VVVVQEPEPMn؃ t 4EPEP荢YYuuuuuEU܋M+M:JM_r^B3͋[>UK3ʼnEE|E E3S3@VEÍuWu]]]]]]9E$u3UUE E  tf;Mt f;Mt uEE0E9 M $ܦBAf;EwjX֋E$ɋ;ujX뺃+tIIt3@jXMjX]3@EAf;EvE$ɋ;uj맃+t/-t*j0X;tCE~A3A;jsj iAjYf;9E$u;u jXuj0Xf;3@3@j0EXf;r2E}f;Mws 0@FG f;Ms߉}EuE$ɋ;+M-D3@EEEuf;Muu Nf;Mtuuf;Mr-}f;Mws0@FO f;Ms}Eu+-C=E3@EAj Yf;jBEAf;Ewj +t"HHtjjXMj3@j0EX f;tAjYf;롍Af;Evj0Xf;9] tBE+tHHu'MjX#j Xj Y;^UuVUQ3@Ef;Mw9k P j0Xf;sj0QX f;Mw  f;sEEEvE<|EMNjAXMMN8u HAN8tMMQPEP̨M yߋE}u}Eu+}P@'K`y K߃`9]u3fMąEσTE}k ȸMf9r}M}MMA U΋3u##։E]]ԉ]؉]܉uf;8Ef;E+Ef;uE?f;uw]fu$FEuu}u}u 3fEfuFAuu 9Yu9tj_EU؉}}~\uč4FAEE}}z];zr;}s3@EztfEIEM}E@OE}uU܋}ԁUf~;x2E؋ȋ ‹UEҸ }ԉUUffify]]EEtCM؋Mm EE MU܉E؉}ujۉU[t3fAf fEԋ}fEԺf;wu@Eփu4Eډ]փu fE޹]f;ufUF f@fE@EڋM@E֋M}f;sfE ufEċE؉EƉMfu3f9EH%Ẻ]ĉ]ȋE!EMċUƋu0ˋË3C#jˋË Ëjˋ[| EffG WwËM_^3[2ÕBBVBB BBB%BByB_B6B; Ku遐U}t/]øMCKKVCK@WCKWCKXCKKMCKXWCKVCKWCUVEV\W}99t ;r;s99t3ɅQu a3@uE S^`F`yj$_F\ d|9~du Fd9u Fdu9u Fdd9u FdS9u FdB9u Fd19u Fd 9u Fd9uFdvdjY~d qaY^`[3_^]jhnK}4@ L~u0j Ye~uhF P,HFE*@ L P@H3@Ë}j YjhmK;uej Yu jj KYe3ۉ]؃@B<@ L}@ L;GuWu0j YEuhG P,HGe/E܅uG P@HGt!G PPH@뇋u]؋}j YËE܅uG+4@ LuuC+j@j YYȉMte @ L<"L @ L;sfA a@Mۋu΃@ LDVYuuE Ëuj t>tF FFujX CPTHtEtAWHt6>%uF @ u F FhF P,HF"F @F"Lt @C1@f;uj Yf @f3rH+j(PSHP0,@ L4H8<(D<9(@+;E ]$Dž $+ʋH;s;>$f;uj ^f0$f8r3VVhU QH++PPVhH8<43ɉ@j+(RPP0@ L4Ht@(4@;H@48;Q$D+<;7j(QuD4Ht (3HDuct$j[;u ?VY60@ LD@t :u3  +,^[M3_UK3ʼnEESVu W}u3؍EV/ @ @ucP4pYȃttу@ LЭKB$ tt @ LЭKA$b Z 3Љ @ AItEht8ltw,8lu @ <6u4uǃ<3u2uǃ-(FDžjsHHkj'XDž|Qƅ0Dž^3 t@tGG@t GȋO@t;|;s߁uy3B;~Ћ uuJ t=RPWQG09~N밋E+Ft6t>0t-N0!u5KI8t@u+Ɖ@t5t ƅ-t ƅ+ tƅ Dž++ uPWj QPPtuPWj0t}~yHPjEPP#u?9t7PEPru(#QPV8x#tPWj tP.Y3Y€_^[t apM3PKBɋBB2BBBB:B|BUU B @tzt-JxM ERP>YYuE]ËE]UVu ~W}WuNu ?t_^]UVuW}G @Etu ME N&S] ~@EPEWPKKE E8u>*uPWj?/E ˃>uE[_^]jhhnKե}u ;=<"LE߃@ LDttWY3uE@ LDt(WIYPHuHut_0茶 uE !}uWY] TAUE~ Pu)sYYuuPuu uQc]UQQK3ʼnESVuW~!EI8t@u+H;ƍp|M$3u E@E$39E(jjVuPQxHȉMu3X~Kj3Xr? Mwic܅tQrYt M3ۅtQSVuju$xHujjVSuu MbMt,M ;QuVSuu b~Bj3Xr6};wbtfPqYtQ3t@WVuSuu at!3PP9E uPPu uWVPu$HVYSYǍe_^[M31UuM1Gu(Eu$u uuuuu P$}tMapUEWDz 3VfuƩu|M UutjٿAu3@3EuɉM yM OEtfuUf#fut f fuEjQQ$1 #jQQ$ ^E8_]UQQMEE]% fMEU} Euu@]Á} u ujX]fMf#f;ujf;uE utj3]UE tjt3@]ètjtjX]]SQQUkl$K3ʼnEVs VCPs u&ePCPCPs C sPEPs sc=lKYu)t%CV\$\$C$s P$PV$VCYYM3^][U S]VtEtjYtEtjnYuEjKEY #tT=t7=t;ubM (K{LHM {,(K2M z(KM zKKEW3tGM DEPQQ$EU E=}3GW3AuBEfEE;})+ȋEEtuGEEt EmIuEtE 3G_tjYtE t j Y3^[U=lKu%uE T$\$$ujW$]舯hu!]E YY]Ujuuuuu u]UE3ɉHESHE3ۉH MCWt E X}t EHt EHt EHt EHMVu 3A1AM3A1AM3A1AM3A1AM3A#1AtMI tEH tEH tEH  tE X  #t5=t"=t ;u)E!MM E #t =t ;u"E M MEM31E X } t,E` EEXE X`E]``EXP:MA A EEXE X`M]A`A`EXPEPjjW(HMAt&At&At&At&At&ߋt/HtHt Hu( % % !tHtHu!#  # } ^tAPAP_[]UEtwP"]C!]UU 3ɋ9@Kt@| DKMtUEEEEEEEVuEE EE$hu(uEEP‰ uVYYE^hu(u=E jhnKC=TL|[E@tJ=@KtAeU.E8t 8t33@Ëe%@KeUE ࿉EUUQ}EUQ}M E#E f#Mf E m EUQQMt -(K]t-(K]t -4K]t ؛ t]UQ}Ej 8"L3U$\$fD$f='If'IfTfs,ffVf%%Y<@Hf,@Hf(4PH+у ʁfnffsf ((Ifs&ffT%'I%%Y`HY,`HfX4pHfV%'IXfTfsff((I\f=0(I%%Y,IYIfX4ŐIfT\XYYY\Y\XfL$ f\\f((If\X\\f%=-?º@+-p< Ё\\f%((IfTfT\fWҺ`@fY\\YYf(IY-Yf( IXfpX+ -ȃခXX'IfY\'IfY\f(If(5(IfYfXfpYfW?XfXf% (IfnYT$ Yfs-fpDf(=(IXfYXffYYfYfXfYYfpYfpYYXŃXXXfD$D$fL$ f'If~fTfs f~Ɂ ځfs4fVӹfnfsfffffvf‹ʁ%=fL$ fT$ fnfT 'Ifs4ffP(Iffvf%ȁr^ f'If'I&f|$fd$f~fs f~%=fWCff='If'IYf~fs f~tRfTfT'Ifs,ffV%%Y<@Hf,@Hf(4PH>\ЁuT$t1 # fnfs f 'IfT$^ʺ #f'IfWfTfvfɁf%=uefL$ fT$ fnfT 'Ifs4ffffvf%=t#fL$ f%tP(IH(IfL$ f%GfL$ f%+XĺfT$f~fs f~ҁ ¹f 8(Ifp(IYɺHfd$fT$ f'IfWfTfvf%=f~u fs f~?uf'IfWfTfvf%=uUffd$% уtf%=?rf%=?s@(IXºcf~fs f~ f'It:f~%=w%rwfD$D$f@HfD$T$ ԃT$T$$@:D$Ã~(=<VЃW?&=VЃ €WXX'IfY\'IfY\f(If(5(IfYfXfpYXXf% (Ifnʁƒ fW?fYT$Yfs-fpDf(=(IXfYXffYYfYfXfYYfpYfpYYfnfs-fnfvfXXfTXfWfvf\XfTf_\XXÃN^YYXYXf%=fD$D$^XYYXf%=fD$D$fh(IfnYfs-fVtfX(IY`(Ief`(IYTfpDfYf%@+-p< Ё=r ɀfnfs-fD$D$fd$f?f3%-K$$ƅp u; ƅp2+at@u tF t2t>-(Iƅpݽ`aAuƅp-(I uS uN uu tƅp-(Iu t Xݽ`au-(I tƅp-(Iƅp u-(I-(Iٛݽ`aAuݽ`aݽ`ٛu (Iٛt øVtV$$vAft^t̀zuf\?f?f^٭^(I剕lݽ`ƅpa$؃#zuf\?f?f^٭^(I剕lݽ`ƅpɊaݽ`ɊaŊ$׊$ ؃#۽bۭbi@tƅpƅp(I۽bۭbi@t ƅpƅp۽bۭbi@t ۽bۭbi@t ƅpƅp-(Ipƅp tUEEEEE UE]MEMEMEMPQRx Ef}tmËT$fT$l$ét)IËB%=tËB D$B  D$ $,$ BËD$%=tËD$f<$t,$Zf$f=tf tf t Z,$ZÃ$D$%$D$%t==t_f$f=t*f u!f ttZmZ,$Z<)I,)Is L)I4)I$)Iv D)IUQQEQQ$MYYuJEQQ$-xEYYDz+ &KQQU$ xEYYDzjX3@3UEV39Mu:9uu|zKAE9EuB9uu=z AEu K K3F9M u-9uEAmE{[U9E u]9uuXEQQ$YEYыAuKuzu8KE M^]SVD$ uL$D$3؋D$ Aȋ\$T$D$ ud$ȋD$r;T$wr;D$ vN3ҋ^[jhnK3ۋujY]};="L"LtV@ uF@ u=GwGPYYt~"L4W%iYY"L@ t PWxiYYG떋uMj8pYȡ"L t7h"L P,H"L P@H"L4u^ tf ^^^NE 2ËujzYUQQSVu W=`L3j щMMXf9tat/rt#wt3F ك 3AfE Stv  tRHtCt- tu9EEˀ@@Euπt}uhE bTtPt;Ht+ tu9@7u-B*u B@u E t3 ؃fEj Xf9tjVhT)Ia/ {j Xf9tf>=af9tjh\)IV0 u @jhh)IVn0 u !jh|)IVO0 j Xf9t3f9huE SuP|{HLE3ɉHHHM x H_^[SVWT$D$L$URPQQhBd5K3ĉD$d%D$0XL$,3p t;T$4t;v.4v\ H {uhC|C$|d_^[ËL$At3D$H3ܽUhp pp> ]D$T$UL$)qqq( ]UVWS33333[_^]Ëjo{33333USVWjRhBQ_^[]Ul$RQt$ ]jhnKuu  xy;5<"Lsq@ LD8tSV迾Ye@ LD8t VUY轑 }E )u}VYZ 膑 }jUVW}WYtP@ Lu u u@DtjjYY;tWYP Hu H3WY @ LD9t VÐY3_^]UVuF t F tvL1f 3YFF^]UW}u蘐菂G @t G G u WiRYGwwWd=YP0 GG uQW:=Yt0W.=Yt$VW!=W=Y@ LY^ЭK@$uEPEPWWVa]?sKE=sA X;r6Q>Yt)EPEPPWVEHL= L3_^[UQQEMUS]Vu W3;tu E E j"Xf9u3j"Xt ffftuf;Etf;Eut 3fB}3ۉ]f9f;Etf;Euf9tu Euj\EXCf9tj"Xf9j\Xu;u%tj"_f9y}u e3j\X Ktfuft,u f;Et"f;Et}t tf3muu t3f3tE_^[SV5PL3Wuf;tGV4FYj=YfuGjPtIut+fRftIu3ufCj"U3ҋ9E vMf9t @;E r]U$K3ʼnEESKVWEE 3WEӋuEE9=HLhWhHIdHu$HWhhHIHSh`IVH?PhlIVHLHPh|IVLLHPhIVPLHPӣXLthIVHPӣTLuHtEtP0H9}tjX9}t5HLKjTLK;tO95XLtGP5XLEӋMEt/t+хtMQj MQjPUtEu u 0LL;t$PӅtЋtPL;t PӅtWЋu5HLӅt VuuW3M_^3[ ljRYJtjJYtKt!jvVtjY)jh@jr1 jUUMVu u 9M u!3.tE tuuu@j^0{2^]SWًu+ފ3FtOu+CtOtJuu_[uu E jPDX @j"UMu @ 8x$; <"Ls@ LD@]? 13]UfEj0Yf;f:s+]úf;^`f;^J f;s+]úf;AJ f;rf f;+J f;r͍Qvf;J f;rQvf;J f;rQvf;J f;rQvf;J f;yf f;J f;_Qvf;J f;GQvf;J f;/Pf;r{J f;Qvf;rgJ f;Pf;rSPf;@f;r=J f;f;r'J f;0f;r0f;]̋D$L$ ȋL$ u D$S؋D$d$؋D$[UHLVV+YMAt I qI AAAAa^]Ë K39 \LUK3ʼnESVW} G @6WYЭKt.W}Yt"WqWfY@ LYÊ@$$<W@Yt.W4Yt"W(WY@ LYÊ@$$<WYt.WYt"WW؃Y@ LYCt_uEjPEP_t_39u~2OxD5@D5WPNYYȃtF;u|fE Gx Ef EWP%YYM_^3[ gUSVu t]t>uEt3f3^[WuMEuMtf3GEPPYYt@}t~';_t|%39EPuwtVj wxH}u ;_tr.~t(t139E3GPuEWVj pxHu5;*}tMap_6Ujuu u]UDK3ʼnEMSA %EAEAEV?W} 3ۉ}UEu%9\u @|3}𫫫j[Ku}HHU܉E̋j^#]ԉUāyIA+3@ju^DЅD9\u B;|E̙jY#ЋE%yH@+3@j]_EȋDMȉM;ȋE؋r;Es3AMJDx.t'Dˍx;]ԉ}؋rs3AMJDyՃMЋUċ!DB;}}΍<+3M9]tAK+K;}3}𫫫;+U܍uUЋ™}EċEХ%yH@EЃNj}Ћj ]ЉEX+jE^T#E؋M UCTE;|ߋEUj+ЋE3Y;| DE\IyMAUԁyIAjX+EЋM3@DЅD9\uB;|v}̋ǙjY#yOGD+3Gjˉ}};E_r;Es3AJDx(t!Dˍx;}rs3AJDyۃMЋUԋ!DB;}}΍<+3 KAE؁yIAMj ]]Y+׉ẺM܋T‹M# UTMEE@E;|׋u؋Uj+Y3;|D\Iy; K K3}𫫫MÉyIAj X+M׉]E؋TM# UMȉTCE;|ߋűUj+Y3;|D\Iy5K5K3C5Ke KuȉE؁yIAj ]X+ÉM׉E܋T‹M# UFTE|ߋ}؋uȋUj+Y3;|D\Iy}jX+KȋE% 𡐱K u@u Ew u7M_^3[`UDK3ʼnEMSA %EAEAEV?W} 3ۉ}UEu%9\u @|3}𫫫j[Ku}HHU܉E̋j^#]ԉUāyIA+3@ju^DЅD9\u B;|E̙jY#ЋE%yH@+3@j]_EȋDMȉM;ȋE؋r;Es3AMJDx.t'Dˍx;]ԉ}؋rs3AMJDyՃMЋUċ!DB;}}΍<+3M9]tAK+K;}3}𫫫;+U܍uUЋ™}EċEХ%yH@EЃNj}Ћj ]ЉEX+jE^T#E؋M UCTE;|ߋEUj+ЋE3Y;| DE\IyMAUԁyIAjX+EЋM3@DЅD9\uB;|v}̋ǙjY#yOGD+3Gjˉ}};E_r;Es3AJDx(t!Dˍx;}rs3AJDyۃMЋUԋ!DB;}}΍<+3 KAE؁yIAMj ]]Y+׉ẺM܋T‹M# UTMEE@E;|׋u؋Uj+Y3;|D\Iy; K K3}𫫫MÉyIAj X+M׉]E؋TM# UMȉTCE;|ߋűUj+Y3;|D\Iy5K5K3C5Ke KuȉE؁yIAj ]X+ÉM׉E܋T‹M# UFTE|ߋ}؋uȋUj+Y3;|D\Iy}jX+KȋE% 𡨱K u@u Ew u7M_^3[[US]3VN@WESS9U @ʉMUUU}䥥u}  ҋ E 3ɉs{E;r;Es3At3ɍp;rs3AstG{U3 M;r;s3@KtG{U}ue ? M҉sC9u :E}M;r;s3BU t'N3;rs3BKMut@ECCE HEsE N@39Su.S  ЋE EtۉSsSu4;s E Etى;sS_^fC [Ujuuuuu u]UEet_EtZfuu uuu u]ÃatAtu uuuu us0u uuuu uu uuuu u]U,SVWj0XuȉMME3}yu tMu U-jG ;wC-j"_8;UZE%=uy3;uu;tAjWP^SRt;-u-F}j0X$xFFjePYYtɀp@3O3 t-F}]j0X$xۈFJ'3 ]u'j0XFB % u3EEF1FMuEԋB%Ew :eEM ~SR#E#ыMɁ}j0Yf9vËM UEEEFOM EfyfxWR#E#ыMɁ%fv6j0F[ftFuH];Et9u: @~Wj0XPVj E8u}U$pR4譤3ځ#+Mx;r F+ F-ۋ0;|A;rPRSQ0F3U;u ;|drPjdSQ0FU3;u ;| rPj SQ0UF]30F}tM܃ap_^[Ujuuuu uT]UMSWu ]t} w )jU3…ǃ 9E w)j"_8}t M3P39-PUYYEV8-u-s~FEF38E9E t+E hĺIPVY utN9}tEUB 80t-RJyF-jd[;|™Fj [;|™FVL^t90ujAPQb }tMap_[WWWWWU,K3ʼnEES]VW} j^VMQMQp0tu(0tuu z(j^;t3}-+3+ȍEPCPQ3Ƀ}-3P~tuEjPuSVWM_^3[SUES@VuHMEut} w'j[3W}8]tM;uU3:-f00E8-u-F@jVY0YF~JjVEYYEF@y&8]t;|WV`Wj0Vr_}tMap^[U,K3ʼnEESW} j[SMQMQp0u&lVuu&S;t 3}-+ȋ]EPEP3}-QPtuEjPSVWi^M_3[ZQU0K3ʼnEESW} j[SMQMQp0u &Vuu&EH3Ƀ}-E9;t+MQuPStSEH9E|+;E}&t CuCuEjPuVWuEjPuuVWQ^M_3[]PUjuYY]UWu MKU} t:tB uBt4 VP*^_]Vhh3V u^VVVVVUQKu KujMQjMQPHtfEUS] W}utEt 3EtVv #j^0XuME39u`fEf;v9tt WVS "*"0}tMap^_[Ått_EtӍM QVWSjMQVu pHȅt9u uEtHzutt WVS耳 6"j"^0.qUjuuu u]3SQQUkl$K3ʼnECVs W|Ht+Ht$HtHtHtHHtHuzjnj jjj_QFPWo uGKtt teEF]EFPFPQW|PEPq|hQv>YYt=lKu VYu6tYM_3^L][UQQE]EUV#t"h,IhHHPHu\u#Et2eeEE EEEEPuEuu u E jPuuuu uH^jhoKe3uu: j^02^39Etރ}tE%@tɃeuuuu uVEPU}EtËu}}t%t@ Ld6PYU8S3EW]]E ]t ]E E]EPYMu@u9EtM+tHHt*Ht#E j[ ttU@}EVj^jZU+t6+t)+t +t@uuEEU E]%;(t!t=t=tJ=u"Fjj^==t3=t(=t%E -j[%j3FÉUEtL#Ex3BU@tME}t U t E t  t EJ} u!Pzo^_[uEuVEPuuuXEusM#;u1Et+uEuVPuMQuEu2@ LdHPYqPHuB@ LdHVuYu Hu 맃uM@ uMu7ZLUYY@ LT@ LUd$M$HEjjj7#ʃEԉUu8tS7[jEP7]踍 uf}uuu7 tSSS7謗#ƒtUM@uE%@u@ ȉM%@=@tD=t)=@t"=t)=@t"=t=@uE%=u E]]@E#=@=t[;ldjY;vFQSS7贖 SSS7蟖#ƒjEP7c MjZ;tu Eu7謈Yj[uJSSR7#ƒEjY;v6"QSS7 tSSS7ӕ#ƒuQjYEHt Hu=E jYEM؋+PEP7L M;ً @ LD$2E$0D$7M@ LD2$$ ȈL2$M8]u!t@ LL Mu#;u}txu HuEujPuVuu2HPs@ Ld7GY @ L SSSSSX Ujuuuuu ]USVWUjjhdCu-]_^[]ËL$At2D$H3BUhP(RP$R]D$T$SVWD$UPjhdCd5K3PD$dD$(Xp t:|$,t;t$,v-4v L$ H |uhDID_뷋L$d _^[3d ydCuQ R 9QuSQpK SQpKL$ KCk UQPXY]Y[Uj ju ]U=2LV5$Lu3cWu95(LtS uJ5$Lt@}t:uPY'QEY;v<8=uWuP tu3_^]Ë@UQVu WVeYN u0 N )@t "S3t^tFN F F ^ u* ;t @;u WYuVYF t}VBF+ʃM F~QRWH G N uttϋǃ @ LЭKA tjSSWc#ƒt2FMf"EfEjEPWE bHM ;] t N [_^UW=TL}wwU  fnp۹#σ+3offtftf#uf#DžEЃSf#3+#I#[DžD_U t93t;DDžt Gufnƒf:cG@LBu_ø#fft#Ϻf#ufft@ft뽋}3كE 8t3_UUVuWz uj^0} vM~3@9E w nj"S^0Å~tGj0Z@IUx?5| 0H89t>1uBSܮ@PSV3[_^]U(K3ʼnESVu Wu}MEP3SSSSVEPEP EEWPȋE(utuj utj[}tMapM_^3[{=U(K3ʼnESVu Wu}MhEP3SSSSVEPEP~EEWPȋE(utuj utj[}tMapM_^3[u}A<5|C 99u0I;s;sAfE*ȀHɈ\3@M_^3[#À90uI;s;s΋M3ff9E$  A3@A03SSSSSUM3tSVWt t t t t Ƌѻ#t;t;t ;u ` @ _#^[tt ;u ]Ã@] @]U }fE3ɨtjYttt ttSVֻ W#t&tt ;u t ;ut} E## ;V=YEm}E3tj^ttt ttЋ#t*tt ;utut=TL]E3ɄyjYtttttл`#t* t@t ;uj@%@[+t-t +u#}# ;P$PE IYY] E 3ɄyjYtttttп`#t* t@t ;u%@+t-t +u3 Ωt_^[UM3t@tttt tVѾW#t#t;t ;u  сt u  _^t ]U EeWu*!tSVt\j=SYYutI;tE=$L38FE;=LuWEY=$Lul9} t$9=(LttL^[_ÅjVY$Lt߃ =(Luj9Y(Ltƒ =$Lt+PSYYxW?tR4ϓ}Yu}'DF<u?snjV5$L^} tY$LR}yލF;0=?%Pj5$L  }d'몋}} tjjSXYPYYtPSS?YPVv uc+MEA#PVHuMA*VĒY}t S跒'YEtS襒}Y'3`3PPPPPUVu3ɋƅtN9t @A8uSWAjPJYY߅uj Yt+PY>u'_[^]U $LVWt0} WPu u <=t tuً $L+_^]+5$LUMSVWu=Eu3MtU u h;vM}uuVPRQ-wPRPQhESP u p}tMap_^[U,K3ʼnEEMSEE VuEԋEWEM܅~"VP2YYM܋} ~WQYY}3|E$3ۉ]؅u E@E$t;ujX~3@~jMQPtHt~+}rE8]tۋuHtъ:r:v8u뾅~2}rE8]tu܊Ht:r:z8u{SSVuj u$xHȉM~Ij3Xr= Mw܅tQWYt MQSVuu$jVxH3PPWuj VxHȉM~Kj3Xr? Mw脜tQ̫Yt M3t5QVWuju$xHtuVuSuuyEVYSEYe_^[M3UE Uȅt I:tBuI+H]UuMu$Eu uuuuu PF }tMapU}u3]SWu\xWߪYYtuWS胖 u 3_[]3PPPPPtUju u ]UMVWuJUu-$3Z}39wu>u R YYAD8tBt0 9M u r9E t B fu9E u}tMap_^U}SVWuM}t] tM;vtkMEuQSW 2+MQPMQP CMtt;t+}tMap_^[3̃=TLr_D$ fnpۋT$#+o fftftff#uf~3:E3D$ST$t :tYtQu WV ؋ ~333ƃu!%t%uu^_[3ÍB[ËB:t6t:t't:tt:tt^_B[ÍB^_[ÍB^_[ÍB^_[UWVSM tMu} AZ I& t' t#:r:w:r:w:u u3:t rً[^_%`H%HUVVdHuVHH^]U0SVW3V]dH}^^ G H$Cj XfKt3fFjXfV@jXf莚^jXf<=FV jXf#jXfG0,H WfBuCSVHH6uSMPEPLHj)tj XfFj*݈3@f WfFj$Xj(f^aYta uSMj$Xj(f^{aYt: uS&j$Xj(f^TaYtP؉^ Cj$Xj(f^'aYEtE3PCMPÉF tMA7_^[#CJC5CtCCCbCCCC"C8CCC_CUVuM|P;EPLH^VVdHff ^VVLHff ^UVVLHuVHH^]UVuL$ PD$PLH^]UM0SVW3V*+EPWj `Hޅ~EMCSt*MD;|EfHE@u HEPdHEPuu܉uuuEHxlu}MGEPM ؅~*E<t4MEPWHHEF;|uHuM=EPLH1uHuHMEPLH uH3_^[UMVfPjj(Htu; f Hff>u;MUfBMfD8 fFBAM;|]J$tHtHtHuj 3jjYBCBCfBfCEfK RPQP3M/_^[UQSVW3مt;WinYt0v(uMhjQEhrYPVEEj 0pHutE;t3f FEMFPV ?Y2[_^UE0jh1pH]USVhh*KMQEPMtC,h|*KMWQEPM_tE0jQ6pH2^[USVhh*KMQEPM tD,h|*KMQEPkMtjuP6pH2^[USVhh*KMQEPMtX,h|*KMSQEPM[t"E0jQ6pHM 2^[U SVWhh*KMQEPMtGEHx:h|*KMQEPVMEx3SSP6pHEtbSPW6pHtR3jZ Q%3pHhXPWXc{M tXPݢ hIϢ3ۍX4n_^[UVu&thPh'6pH H^]UQSWu؅u2%Sjh 7pHSj h 7pH_[Y] $3ɄUV3} uE PhjVVVuXHtjVVuHHPtHPLH^]Uu;E tPhHu]3@USVuW}9>,] hI詡MPWj:Yf;t1j;Yf;t)j]Yf;t!;wAQMWP빺I"#s3`H]PRWj:Zf;tj;Yf;t j]Yf;f;uMhIDPWE@PˉEVMj;Zf;u f;uEQM9>v>WV t uG2_^[]USWًM hIi}jW(PHWPVVhPdHP0ShCW\H06h+KPLQM 輟jW~^ jWq2_[UM ]USVW}hPWdHPH؍PJYYu"0;uSHt33@_^[UWM U ;WvWMt G+;vO+QMRWoE_] U,SVW3ۍM艟T ML E puuSTf8[>M FPTf8](Fu EEPEPEPEPV+KM t +KMt+KMt/EPVu o4+KMtu؃ kIYC<+KM`tH+KM:tu؃@IYL+KMtu؁HYP+KMtu؁HYT+KMtu؁HYgX+KMtu؃cHY>l+KM[tEPIM!Eu 9uVLJ迠tD4p8t+x'VFPVHNYt 8y3ۋ5\HWhPCu09u6t-P0LJ(WhPCu֋t PMKMC_^[UE VV0hPCudž \Ht P2^]UM ]U, SVW3ۋ\$ uhD$,PVdHD$(P:=YȉL$ t$qxDt(PGNYtCyL$ u4;8;+;QD$,PF 00D$,P$8hx+KPF$DPEn_uVOhqD$ tiL$QhjPhwVXHt$ t<9\$v6hD$,PVOr3f$,D$,PEYYu3CVOq3Ft$ tSh$4PudH$0PL$D$P(L$&PtCt$ F t!]SlH9RCu D$Pu|HD$D$D$D$D$PuhHPTH@t;D$uCFy;D$uCFtD$ +D$9uCFtD$$+D$9uCFt1h$4PudH$0PCYYuCFt1h$4Pu0H$0P\CYYuCFt;u00;uCF;u E33@_^[]UVtQbj"YtM3^]UVWuDYpVGOPG!VuPP_^]U} uusD$$PYt-Kp@3jF(Yt -Kp3j F0Yt`8-Kp3jF,Yt ,Kp3F4h,Kh,KPQEUMEJURjPQDv(PQ F8Pv4QRLURhLHPxv4EjjPQEPQj7(HFPpjv(jjQR,j^PQ8Ntuۋuy%jjjSVU Rh,HPyjjjW0E ^SPQ M QRxԋM@3QQQP`Lf_^[UVj }Yt -K@p3j[Yt -Kp3jF?Yt ,Kp3j F#YMtH-KpH3fF NF^]VW39~ t v WY~ 9~t vFY~9~t v5Y~9>t 6&Y>~_^VV8-Kt RPf^VVY^VVY^USVW}3ۋGtXE tw1GU@ Rh\HPxgEwVSSSPQ EPQPQGp0QR x4jPQ(GPQRjPQ$Gt@3@_^[]UQVW39wt5j@Ytuu uW|t}t Q3_^Y] UMA@A]3@U ‰EMu @tSVWjH5HjXSjZSSjE H]5|HW3h u}sh ։G_^[UQQSV3ۋV ]] FPpjv(SjRQ,8^=u8^E S]VpW ytA;Cuu tBOu_^[] UVutt Q^]3@UEPEpHEPu H3UE@tE 3]UM tE@t @3@]UE @]WWUEHE 3]UM tE@t @33@]UESW}3ۉGH E GPuHGPuHMYG_@AY Y3[]UVutMuDtyHt~<ulxuftjQPN FPvjv(jjQR,?Ht8xu*eURh,HQMtQPEPQjQP^]@ UE =;uE j Yf3AfH39=+uE jYf@=u E j Yf3=t]$UVW}H:tN(E 3HtN0ߺ~E~~FEN$Iotv$vT׍EP,HP|HMF@tE+E+E+‹MF}tE++E+‹jWuSQvTHEPvTHM4E+E+EEPjjvTxH^z"Fj 'K,Ph vTHFX_3^@[UVhvTHtahQP0HFtfu jH4^zh vTHPN4o}jvTH^UVW3}SjvTHEtiMQP|H}M;~ Njȉ}M]U;~ ËڋЉ]U+ϋ}j+RQ+ Wj X++‹ȋE j[QuHjvTHEtaMQP|H]M;~ Ëًȉ]MUE;~ UЋEU++jRA Q+‹ȋE kWj[+PuHhvTH؅tNEPS|HME;~EMUM;~ ‹ыȉUMjX++jE QPWj SHhvTH[tjOQM Qj j PHjjvT@H_^ U} VuhIN4{jvTH^]U=2Lu3]]UQE 2LtgtO-t3HtHHuu_EHtHt3TOHF?zTuEBTN-E@@rMPPu3@UVuWt&~tv~t vQ:_^]UVVut3^]Uut@]U} u E``DVW}E PW9u V?yNOwf~FGwf_^]UQSVu 39u2MWy;txMJtGAG>9_tVUBE@;~@t;UJtGAG>9_tM AE @tM @UAËIJ !LJ !LJ_^[UVWuCu>jdYt c3uK}GFGff7V:F_^]SVW^WY;uSYu2_^[USVW/KNE F3PY%EF/K^^ ^$F(@F,EPdHj ]][EPNKuEPLHM 9_^[V/KQvY^VWW,/KG(HD BG(@H;rO(~O OO_^C9UVEtVjY^]VVLHff VJY^VlV5Y^VW3G40LH$|_^UEVWtH}tA0MMuu`H3 KU4uF rM_^M7~3UUwA3]UEuW @]UM t%Ht"wEu @4uuQ 3]$UM HuM Hu@VuVPE03^] UE xv&EtuuHHy  3]UVuFP0HutQM3^]VW39~vF tQ F$G;~rf_^UVF 9FuP jX;rW3jZF  Q~YtFtPvW-v~_jYtu63ҋNFF^]3AAA PIUQSVM L/KWu3~~~ ^ ;F$F(AF,AF0A F4EF8EF!EGURuPQ8EURPQ UEr(RPQLtEPQC;]rGPQEG^[_UEHt uu Q@] UVuWN~ t QPW0Hu Q3_^]U0SVW}WuHE3j[ QY3ɉFËىE]E|9M2j ZUE(Af9OtOf;UtFAfXOj XCf;uE@j|EFZfXj CXAf9Otf;UtFj fXACXOf;uFj;ZfXj CXAf9OtUf9OuAf9Ot3BXAf9Ot+f;Eu j XAf9OtOEԃ)t F}f~ f1 G@;|_^[]U$ VhPv`jHPHPM'~Et"hIuuu 0h|2K;xuu h2KP 0u h2KPPM赧uM+h2KM+uM+h3KM*huujHM舤M耤^UX S]VW=HhP5`!Lj׋5HP֍PMhPu jP֍PMS{&SE6S`M̋覰EPV~tuWh2KPWh2KP PM肦]SM)IVM)M>}|8SMBjuM趉h3KM)EPM)VM)h(3KM)EPM(=!LtuSuWuh<3K"huujHMMM٢MѢMɢ_^[ U!LtM; !L~I~@ Iu@]U!LtM; !L~I~@ Iu@]UM; !L}x!L4M E M Ǔ2]U,SVW}j MYj 3^ӉuWf;tf;uBWj"YMf;t j'YMf;uE <"j>YM] BWEu;Ƌu ]t%]MftfNABW;EuMM3f9 Wj YBWf;tf;EtWft ;E3Vf FnVjM} Ex@t9;ujOxg]CjM,PM }i}jM,SP~hKKuOPM }(}}Ktj}t jPXSP$ 8DjMh }t ~l^}~VFBj M/ }E}E܋P ~jM FY~jM hM }t ~|}tR~FhM }t~F}t~FkEPf~\jM> F~?jM! r~&jM Fl~ jM F~j[M F5~j[M F~j\M FEP~j\Mr Fu~ t jSan~ujMJ EPm3ۋWM)f9t'WM)0PM EPG8^ujM E܋PoM=M5_^[6D6D5D5D6D6D6D7D07DX7Dr7D5Dl5D6D=6DUVW} ~GSMTuw 3EfEEP^S=EPOuS [_^UQESWWMHf؀8] t@V5tHQjjW֋MPu=M5QjjW֋MPu!M^_[U(SVW}G~ ]}EtPHtÀPHM<u~u ~uu~u~u WPhWPhEjPhv xH\ t!AQ<ujjuu0ee3fEGfEj3ɍEAPQMEH_^[U$SVW}~ ]}aPHtÀPHM\<u~u ~uu~u~u WPh WPhv xH\t!Q<ujjuu0ee3fEGfEj3ɍEAPQMEHd_^[UVuXu^]UVuW>u~u~u~u ~ S+w hHPHt]>t M~t M~t~t~t[PH>xHu~tG&Pjhw Ӏ~tG$Pjhw ӊFt=~uuG%  PjhtG%Pjhw Ӏ~G)Pj[hw p38tG'QSPh8^tG(QSPh8^tG$QSPj8^tG%QSPj8^tG)QSPj[{[_^UVuW>u~u~u~u ~ S3w hH"PHt]>t 20M~t 20M~t0~t0~t0[PH>xHu~tG& Pjhw Ӏ~tG$ Pjhw ӊFt?~uuG% PjhtG% Pjhw Ӏ~G) Pj[hw v>j[tG'QSPh~tG(QSPh~tG$QSPj~tG%QSPj~tG)QSPj[o[_^U(VuxwujkseEPHtWuEyjK]E]jpHEPHM+MEEMEm]賢}]{VpH^UQSW}مu { eeVtH} jHPHHjPVC39 u!EPMMVEMGu H 腓뷃UVW};~vkjX;rS@3jZF  Q艫~YtFtPvSvثNF +PjP ^~[_^]US]VWG tQ&jYtu f93G_4^[]7VN,VMY^UQSVWjªYt O3uOP}$EP7<_^[UQSVWjnYt Ol3uPO}C$EP7_^[U8}SVWt}}tJdj,EjPE0; }ueMEPuMEUȋRjQPHE܉}uHEM 3҈SE2UЉM}}+t'HuFHu WFMEC"f9u E}u ECS~t7~t1|,9u&PHȋEMt QH;~ MAEMQjP3Hm W 3_^[USVuف}?W~m<tQT'; u |?u N}}3 _^[]UW?t7MV0FP"葛Q%tW H_^[UtWd!LVhI_V辈Y3@^]UTVVHu L$QVHu PHD$^]UESVWPW\Hu2VևYPEV3PWETHuV諟3jZ Q裇hTIWϟhTIV脨h6KWhTIV膬ujEPEPh6KuXHt,Ej0VjO Z`jVjO(Z`u h6KWYYhTIWVW VWYYh7KV袡YYu*jG PS蕵u3fC9W3EPEPWuXHtXhTIV荧YYu)EH PPQPRh,7KS諨huS 3fEu賆W譆EYY_^[UQS;Mu!V'XEPuSVHVzY^EPuSQHM[UhVWPhHhPHPHtwP 39 t @A8u;~hX7KW貝YYHjtEP~ uHPP VWoV褅H hIWSYY_^UW;}u#V WhuWHV^Y^huWH_]SV3Wf9tP艦YtG~f9uVY_^[3UVP3PPQPHP^USVMW^VPM}]3SGEEYt3GfhIV荛YYhIVxYYujX^h88KVbYYujhH8KVMYYtEhT8KVVPEP2YY5u23}tލPP$Hu>PPYYtPPH6/PPVVPΧhTIP赖PP袖$f9tPP胖YYt0jYKPPYYP3fEPYY3fEE荅EfEEPuuuuEH^UVW}hP3WFdHh6KPjYYu=3L3_^USWH=2L}d|;Gsj pH=2Lu3ShDwD73LH3LSh|6KSP2LHt6 3L653LHSShWpH 3L28SSj53LpHhpH53L0Ht S53LH_3[]UVW}?;uE90u2S] ;} +Ǚ}t;}ÍE;!#~!+}t;}+E;}8};}+}t;}; ~+ƙ}t;}+;}7[_^]U VSP]YatbPu HJPY3fEE3EEEEEfEEPEH[USVh8KMQM?7u3M t:@t1 u jSH13tA3t@VPQjjj\H33@jPHM21^[U(Vxqujes_EPHtQEPHjpHEPHM+MEEMEm]Em]u 'K=;rVpH^USVWM]hh7KMej"MLWM{j"M~Lht7KMd5H3PhPh7Kft 3PPPh7K3f9t-3WWWuօuWWWth7KWWWh7Kh7K֍MO_^[USVWM_S]3t'Vf8 tVPMKF;rٍEPMEO_^[UQQVW3WWjVxHEPhjWWjVXHu+EPVHHuWhHWVHV H_^UQVWu3Wu W]YpS3PPVWjPxH؅t13jZ;| QAxYSPVWjjExHE[_^U,SVWjMYpJ}j0XffjxXfCE]px9{]<yjYfLUfDEfOfNy֋]E_3^fL[U SVC3UwK3W}A7wMu~0uQRPrMEWUFEM;|а_ E0p2^[U VWW@Hf>[VYK}S] jEVP败3fEEP4^VfŎrejEVP肥3fEEP4^VfG蒎r2jEVPO3fEEP赗VfGbt4^VRYjEVP 3fEEPs4^VfG]rWjEVPӤ3fEEP9VfG r(jEVP褤3fEEP fG 3fG[2_^USWSU虍+ƒY;t2JV3~@fsfEfDsfE3jUMfEDYtMƙ+‹U ;|^_[2UQSVWW%&Y3AP3E0x?Wf;Er 9w0Ar Fw7 ar9fw4WJC|tOxtXuj0Xf9u_^[Ã&2UQVWu3Ku W艌YpS3PPPPVWPPH؅t$;}VSptY3QQSPVWQQEHE[_^SW3PPjSPhxHt-V3jZ Q"tYWVjSjhxH^_[UEHtHu=u Lu u$= Lt$} tu Lu u^2]UQe= Lt!EPu L+[tEPu Lk[y At@US]VW3~~CFtCFC F Etq3j Z 3 PsYt Mh~#׉}CNPUG U;>|_^[]VN U^à HUVt)F jX3jZF QbrYfEFf3fH^]UVuWFGFGF PO FG_^]VhKDq6j ZVgrY^UM u3%EVu;} t+ʋ t+֋^] USVWM :uu ,H[3ۉ]9]u3G WM ,f9tWM Gj;Yf9u܃}vGPM j;Yf9t3j Z 3 PqYthPL$TDB뺃d$ hIL$4j ^Pf;tj Yf;u7j[Yf9tFj_^7ޚPYu7ǚf90uQAˉ賚PL$4Aj ^P藚f;tj Yf;uPyt$j[Yf9uqhIL$D:7TP脐YtQAˉ7PL$D=At$@躏YD$ [Pf8]GPf8;u ;C23ɸKL$,D$(uZt$PPYD$,Yu)L$$1t|$ ~L$$HL$3AL$,L$,D$(=K|D$$=uM|$?d$,D$,PD$PD$PWuSj8M D$,;=uAt$0裎YMt!t"ttttj[\|$ D$ Et$0t$ V&L$T$D$@t$4L$t$FTL$FT$$TL$D$0PF D$ D$T$L$ЋFT$TM D$;~D$C9j}}tlE0E 07w\$E7;T$}!j _C4CtB;T$|}L$Ctt$jX3@#t$E0E 0VMƉD$3ۍL$0)BL$@ BL$PB_^[]USVuWjLt=} ';~>Ct M MVA07YYt;| H} ; }xCC E3_^[] VWN3t Q~FtuvkvwkYY~~>~ _^UQuju uuY] UeSVWEPEPuu}7GM|\UTMEt E;|j_u袡&F !tuuQPWVSu Ethuc+}tRtWM *M *;~SQw*YPVc SQM b*YPSMPvc QtWVW@t&t M J*>uF tNt t M jt M Xu]藠EF JJtsJJt8t M CV>^uOF ^t M C>u&>t fF UF Lt M pCft> >t M RCt>>uƟF >3_^[UE SVWc}Y]+]} MVKE utaF9X}FXCSjvM M$EPMSBSVuaVYhXF9X}IFXC;SjvMM$EPPuE t?sVgSuWa֋M$V,@VgWgY@3jZC Q5g4VuW`M$3Wf>?WgYM J} tnuF΄tD `FPM6M$EP?jMsE t E#jE# E jE Pu'` JE tjuE#P`fE# PjuE P_ u MM$EPM<_^3[ U SVWM}E xuu3>F 33C9XA@30M} }}jMFuMOCMpޜ]uMEPE PEPuE ΅u賜>}^ 褜E F M萜EE j_E p;vu]&F u=@j)8 u(BKyu$F &j_E @MSjutEPdE 3C9Xvuܛ&^ ju1@j)ȉE苋uMBNyu褛^ VuEPgM膛_^[UUBABAB A BABA]UEVME FEFEF EFEF1:^]USVW}GFG F t@G$F$t@O3SVO SV OSVOSVOSVOSV_^[]UE3AAA AAAAA A$fAtt]UVW3hFF8K~P~ ,HMV,W:~0F4$P\H_^]VN t IujN$^t IujW8Kw, Hw0 HwbYGPHH8K_UEV8KtVbY^]UVEtVbY^]Vj8 bYt V^3^USVWwV@H} _ t"w Mw Mw6"PU[ VPH_^[]SVWwV@HG40P\H=u39_ tVPH_^[USVWsV@H{ s MMs Ms!PZs jsyC VPH_^[]V>t 6 H&^VNNNf^VNN N^UWu! jujRDHPWDHP_^Et!uuWEPVuXHuSu THuttj֋>YWhjEPjh@h8KHttjUYEfU VW3E }}tjTHuuE>_^t!uuWEPuVXHuRjTHuttj֋uYWhjEPjhh8KHttjU=YEhUt]I$t]} t MhI63](UYt]I$t]MhII63]SVWFPF P~W^Ssu WSjj_^[3t9At@UQeKt0}t*} t$VjEPu qu6Hu^EAPAPQQ 3t9At@UI t]} t MhIs53]UI t] MhIB53]SVWFPFP~W^ Slu WSjj_^[3t9At@USVWhs4Vu\Hh \P}C[YYjCEPhWs,H}sV@HC M9CsOC E{EEyjK]E 'KPC[s CWs UW[M}C CQWPTEC VPHjEPhWs,HUuW[YWV\H_^[UMt]UQV39N0uEPQVhߙDQQ8HF0^VW~0?tSS^43S\H=t>V@Hh7`Hh7LHfhS\HVPH[_^V~ utN8ȉF S~$u'tuN F$^&^VN tu^]VN)VSY^UV~ u>tM@3^] ;t23V~ 0x;} A;|^2^UVW }; S3ۅ~ $$CI; |x$ tjjV9y tSH:3ɉM9 ~J #t u"M$$AM; |M; j[_2^]V~ t^tW P3~ S ™ [Nu[_^UQV~ HHS@W3j_] QzQWpQYYȅt3ɋ3H9x~D<t0jCQYtM cQ`s3ۋ]$G;x|_[^UV2jPUYt!0PA0jp3ijPYA@F @^]USVWˇjP3Yt>~~~ ~Eu EAEAEA EUttQ C 3Mk&_^[]U$SVWF H $ DVU*t2ZSOEY׍IW$PUYZujOSOYSMEPEP@SuWI M%\'EFjEj]3CE @Ej[S(OSEPWH6j3OYjNYyF _^[ËDDDDԥD٥DD٥DDDUVF ~GW}~&t&t~. ~ u$9G uW趞EwN腪_^]y u@3Uy uE JHJHJ H MhIG'E]VNt Q调f^UVW%jG MYt 03E7_F^]U8SVuW u2w@tF0vutJejYM~+F EE@ىEv;|ujWY@YNE%=k=T===6EPV.&$DjC IYPdHW3HHy3LH3I#Yw譀C 3wwwދwًw 耀C 3{G]gEC Go]E5iK3j9wtHYtw"HYt +sC EfEu//GEPQQ$4HEPEPEPEPEPEPTh8KPj TP3!}E̥PEP8HEhI΃hIW!jj*ttPy|Mtu&h8K!jj)MEP:MhI jj*MEPM뜍EPdHG 3VURVuuVPQ,Ej Y%j+HtYHt!C MGYu萕tC ,GYt +*uω;臼u HCC FYt )E;GK FYt uf3jXfEEPLH#EPLH2_^[-@w$DjC nFYPdHj YfG AHQPG0G0G0Go0rw\6`J7xG5|G#jG3t90tjEYO1jGf8w*DDDDDǫD̫D4DݫD+DDDJD+DDJDjD~DDDDDDD֮DD#D5DJDJDGDdDJDuDDJDJDJDDîDDDDDDDU(SVW u~ j*[SikSYkj[S>%u)S2%uvOUmS %t_S$tSEPEP֋M!MSjtSjt2_^[VzjF CYt 3^UVWzjG _CYt ^&3uΉ7D_^]UQQS]V#cWM C ϋ`Et2zC trt>PK]yEEj_{ &PK]y{ yEj_{ y{ ('Ki8uIyC QtntjzQQ$=~YYAu+uPK]4yC EpzPK &KȅtCt?˩u+t#txC 7PK8y8titaM VyQQ$JyQQ$p}$(~]{xEj_{ tRy]UxE{ 5M xQQ$xQQ$}]"xEC mtUEuKfuFxjKz2xjKAu=ˋwC 3{M w_^[UQQVW3 u=QQ${YYt{XdȉMUm]EDzX u  uCW t2t |s_^Ãy ut u xtà t2Ãy u3V~ tli^@ËA ~~t u@Ë3ËA $tHtHtHtHu"A@EjjXà tHHt Ht3Ë@ Ë3@ Ku3L3L 3ȋ%X:3ȋ%3ȋ3UQQ Ku3L3L 3ȋ%X:3ȋ%3ȋ3EEyjK]E iKV3F 3Lֹ3L3iel‰BF;u r_^ U츸8SVW33h]ԉTX\`dhlptfxf}4YPM蟇tWs33Fˉuht2KuUYYQ\PudPLPTPEPu t]EPlPLTPlPFLdPLPTPEP\P)]$LPlP LdPlPKlatjPE 3E VVEP3EVjP豃3E5VEjEP薃3EVjP膃3E5VEjEPk3EVjP[3EVjPK3EVjP;LP\Lh9KPrYYEuj Cw$PtUυ;~+3PVuM̋ˉE‚E}Ѕ~(]uЋQQt03F;|]ԋE3F3PuM(uuVu6hM̋U;wuuPsY9utLPHj }3fxfLPTTX\`dpt}hl u VT#T8t9LPHj %u WVLPHuLPHj_LPHEPEPVTMU_^[ USVW3Qw373ۉMCω}ff]QxPuVtjXC7ESSP軀7ESjP諀7]jjEP3萀E73ƋujjEPuM}jj1舀6tYSEtuY6jSPE9Nw$QSuS]SMu;}tVWYSWYj ,}u_33ff@M؍SIWVAWE Y03_^[ U(SVW3E3EjjP[hjEPEh 9KPEsYY3EjjFPˉuu3<6WjP~?PWPT33jf=jEP~u3 ˍ<6Wju ~yu PWV u3f7POYYtmht2KunOuYYutS3GWW3~3EWjPM~E5EWP3^~E2E<jX_^[ 3UVjhjjjh@uHtuju VHV H^] UPh4Hujh9KP8HUdSVW3WW6}63CSj@EPq}Wu6}Sj6}6ESjPH}6}Sj`P1} f9u Sj6A}Sh62}k(S(W6!}6ESj(P|EEjP6|_^[UVhuF$Px[ 3f,^]UVhu,PM[ 3f4^]UESVPI@FtdjZ;rЉV 3ɋjZ Q>,3YF9^v?Wj+,YtEH gQEN3FF0G0_^]Ut@E ]Ut@E ]+I VN ]bNUbV+Y^UVLfEtVi+Y^]V'VS+Y^VtQV7+Y^V載V"+Y^3U\ K.=LSVW5HSPjf5L֍PMySPjr5L֍PMXRR]RE]M܋ EPV]tu܋uVh2KPLh2KPLuPMtSMChIM6M } t1h9KMu MEPM腅hIMh(3KMEPM_=Lt>}tuSuVuhh9K~Q5uh9K`Qhuu5LH38MLJH%q@LMMMM_^[U\ 7,=LSVW5HSPjf5L֍PMeSPu5L֍PMCRπR[RE[M̋ EPV[tűuVh2KPJh2KPIuPMtSM.hIM!M } |}tuSuVuhh9K^O5uh9K@Ohuu5LH3@tEMܣLMMMM_^[U *V33} VfhPVu HPu VhpHMPKE^UEx;}Py0M i M 2]+I+IUVuMEPlM^UVqcUΉPcM H^]UQ} SVW`Etu[u,} t L,e;rE_^[LVpP~% L5L!5 LY^UVW3j 9~u$Yt u>"$Yt uFGFxF~_^]UVW}QAtBtP;u;NuVQ['N_^]UM u}tujhgupH3]U'EPPhuH/SPh0DF8Cp2FjW0H} ϋDG 7"ulH=u_}tYCpF0HC0ͫF8Cp軫FjW0H} ϋUDG 7_^3[U4ESX@VpWΉ\$3jNT$ D$ AD$$AD$(A D$,}t$$jjjjjhF @HE@0迪FL$0QRPvE@p蛪FL$0QR$vE@p wFL$0QR,vE@pSFL$0QRv!E@p/FL$j0QRDUBpmFL$00D$PD$PD$PD$PD$,PD$DPz5L$0Xt=L$ tj_D$ t|$tuuD$ |$WPQ4U\$v/BpXXFˋ0D$8`PVt$WD\$vE@H D$0:Pt$VIj tXc,c0QT_^3[UBSVW}كv;GHu+G0N P~YG0蹢FPY<uM P)G0膢FM 0jHjI_^3[UES@VW3S0EP/t/Eu ΋@xX:F >^ 3HSGWu :~ _^3[]USVW}كv;GHu+G0象N P|YG0膡FhQPHt P!jHj1G0EF0M _^3[ULES@V0WVjD$^_^3[]US]VCL$X0W3NF$Q0Hȃ$D$L$D$P$D$T$D$X$D$D$QD$LH{v CHOt1OtD$DPPHD$$PD$H,D$TPPHD$$PD$XD$LPPHD$$PD$PPH{vZCH3C;uKD$0PD$2PD$4PD$6PD$6PD$8PD$xh8KPM D$`Pv3Cu jSVD$0PD$ph9KPD$`PL$8L$PjSD$PV;2L$4L$4D$&P9KD$dWPk D$`PL$8HL$PmSSD$PV1L$,4L$4:D$*PD$dWP D$`PL$8L$PjSD$PV1L$3L$4D$,PD$dWP D$`PL$8L$PЗjSD$PVJ1L$3L$4D$.PD$dWP D$`PL$8\L$P聗jSD$PV0L$?3L$4MD$0PD$dWP0 D$`PL$8 L$P2jSD$PV0L$2L$4!M hIqT$\jjH_^3[]US]V{WMuTICpٙF8C0șFW4sY<uM P8hTIW YYM uhX7KhIUjjHI_^3[U$d$d$SVW}كD$,uGHBD$ uD$ G0N4KG0F0D$4Pj\XPD$_3^UM3V9AtA0ŐFjPjHtu [)&F 3^]UEjpu P]UPESًH@MV03ɉMWοQFEE@p9FM hIEq3P3B;u33؈\$f9L$(+u -u3RtgrtbAtYatTStKstFHt|$ -jBPju 腱t$ SSjD$LPu t$T\$\D$`$L$0$L$@L$0D$jSL$HaG+L$@P7t$0D$@PL$dSt$D$hjPu oL$`jSL$8G +GL$0Pwt$0迲D$0PL$t誀jt$D$xjPu L$paWD$YNJL$0ZL$@QT$$SH jHjFL$(7L$P_^3[]ULSVWL$8E@0#NT$8UhYPL$$M7\$ j ^t$8fshSHD$Hf9s>j H3Y|$t 7wwt$|$ωL$7t$~ZD$ T$f94Xu=Yj Yj Gf XYt 0ppƋL$T$AȍCD$ L$C;||$|$\$CPju 3@VPD$HD$h9KPYYt'Puuu ut6h9K׍PVHuVH_^[VH23U\SVW=HPuM2׋t\hIPYYt3h9KPYYtuU NYPVHuVH}Ph9K׋ty=H]tUhIPYYt>h9KPsYYt'Puuu ut6h9K׍PVHuVH_^[VH23USVuWFL$8jt[j83Yt *F0Pujv('uVtQ'u F 93SW|$D$PtЋD$xG(u붋uFj pPG(t}vt+Ft1HPΉD$f8 tt$f8 u V>vFPL$LVL$Oh8KL$y2D$PI>L$7*MЋII]PR>uu F EjH tt)Qω_,_0%_^3[] U|SVWuMMkEE܋EEEEEh9KME1PuHEu}MH u j pHhIPYYh9KPYYEPMNPM"1t>}tV}tNhTIM0uMuVWu u؄tA#U 3 J}tWPuH 2ۋEPHM5M-_^[UVWM dpE0x3M Xt';}tEt9u2_^] USVW339Wv3]3ftPEf9EtAKfuBF;wrӃ_^[]Uu uj Ԧ]Uu uj]Uu uj謦]Uu uj蘦]Uu uj 脦]Uu ujp]Uu uj\]Uu ujH]Uu uj4]Uu uj ]Uu uj ]Uu uj]Uu uj]Uu ujХ]Uu uj輥]Uu uj訥]Uu uj蔥]Uu uj耥]Uu ujl]Uu ujX]Uu ujD]Uu uj0]Uu uj]Uu uj ]Uu uj ]Uu uj]Uu uj̤]Uu uj踤]UEV@MQ膮P̅u ΄t EF &F 3^]UEV@W_F 3^]UQSVuW^t FvNIuPjD$PW|$ tM VVYu AF >_^3[]U SVuW~33ۉMEvFH c؋Ev FHNRURURURfNU1IRSPPPfu*u U&3G~ jHW諩3G;uM Pu SWV聚EejEWEPV}M,EeWEWEPV}MuJEejEWEPV}MEejEWEPV}tM_^3[U4ES@VpW3jΉ]R΄t3@EEP*jXElNE܋AEAEA EM܋EAEAEA EEtM܉E4EtM%EPu'u F SHj RH~SHju &EQ@MQPu ΋>F M蕣_^[UQQSVuW~3OMy u@_ ]{ uHHtJHtkC8FpbkFWER@H0eP]P61kCFRHp85P-P%PajMAM8FpPWPPȀ+w?۩MPҩPʩP©P蛀u ΋J>F _^3[USVu3CW3}}]9^vFMp虳̍EPyFVP裉u ΋M^ >_^3[UES@V0ًHWPP載yjHW 3Gu ~>_F ^3[]UES@V0ًHW躨P貨PjyjHW0 3Gu ">_F ^3[]UEV@WH0aPYPJu ΋>_F 3^]U $VW蔭}vGphvL$ hDGphFt$GQPu ΋hL$F >m_3^]UVuW3~v FH舊N 苧PjWjjjj{u ΋>_F 3^]UVuW3~v FH3Nj 4PWjjjj8{u ΋>_F 3^]USVuW~Mb] MEv#C vFH¦Ev,Fj@ȉEt{MgEMpBvFH ~EvFHkVJ2QQ$uuuWAPˋC 3MҞ_^3[Ud$ SVW}w\$D$v GH ؃vOqL$̍D$ aPSGpfFSGQ蛥P=u ΋#L$F >_^3[]UVu3~Wv FHQVPJ2CP;P荖u ΋>_F 3^]U8ES@VpWM3jΉ}S΄tE3PCx'j[eNE؋AE܋AEA EM؋EAEAEA Et M؃@tM3]EPu%u 3@WF >PH-EM@Q:PDu ΋3@F >3Mǜ_^[UQSVuW~}vFHE~v FH ֣~v NIãuVWJ2S诣P解Pu ΋/>_F ^3[UVu~Wv FHgNP \P'u ΋>_F 3^]UEV@WH0$PPyu ΋>_F 3^]UVu~Wv FHݢVPJ2ϢPǢP2u ΋O>_F 3^]U SVW}3ۋw]]]r%Gj)@ȉEu]KcCr!Gj)@ ȉEu M=Er1Oj)qu$EGH $EGpbuFuuGSQݡP詝u ΋e>_F ^3[UM39Av A蓄VWPu ΋(>_F 3^]USVu WjjV3-E 9Xv @?؍EPEPEPEPE PSE 33WCESEPV}]WMESESEPV}]4MyEjESEPV}]MUEjESEPV}]M1EjESEPV}]M &3@jF PH_^3[U$SVWM觥3=4LtEP(L¨t]hIM}7߉}}}]=4LuWHj褜E9x@ȟ} jPW}jjjW5M3@PPjWF EjjjWF lEjjjWF HE3AjQjWN &u E܉MF 蟗_^3[USVu WjjV3蕌E 9xv @见WEPE P跧3tKE 3WCESEPV}]MESESEPV}]MjHGW &~ _^3[U8ES@VpWM3jΉ}j΄tE3PCr'j[^NE؋AE܋AEA EM؋qEAEA uEt M؃WtMJt7]EPu%u 3@WF >PH)-EM@QMP踦u ΋3@F >3Mڕ_^[U,SVu3ۃ~W\$vFH؉D$Nj9DuSjj&jc3jZ|$ QY3ɋ؉L$FjQjj0f]NuD$(AD$,Ajt$D$8A D$<Fjj0S?D$$D$PD$PD$PD$PD$0PD$_F ^3[]UQSVW}3ۋwE]t G̚Ev OI蹚؃v OI}EPSu蒥_^3[USVuW~M] M3EE#C vFHDEv%Fj@ȉE舝M }Ev(FjX attZsMT6] vFHڙEvFHǙN EQQ$PuEuPWˋ.C 3M4_^3[UVuW3~v FHP|N17ZNPPWPjP1Pmu ΋>_F 3^]USVuW3ۃ~v FH{؃~v FHN1YNjjSW1jjlu ΋Z>_F ^3[]USVuW3ۃ~v FH{؃~v FH|NS WnPKu ΋>_F ^3[]UE39Hv @${ȃ=HLuVu &F ^ Q(LUp3]UVuW~v FHN zWP茤u ΋^>_F 3^]U_^]UUffBABAB A BABABABAB A B$A$B(A(B,A,B0A0]V̖NĖN 輖N0贖N@謖NP褖N`蜖^V4=KvY^VV HNXNDN4蓉N ^銉VN`NPwN@oN0gN _NW^OV,IN^UVOEtVBY^]VLV,Y^UVxEtVY^]VtQVY^u3QcYUSVWN3߅tVRXIuMS0aȉM9~v)Fp0P譫FM xC;^r_^[]VW39>t 6 H>WWjWH3ɉ_^U} VtuuS^TW}jGxjwpw0w PwvHjuhᆳj eShw`PHu Phᆳj/E PWHU 3 3 ЉNV8Et W jPP ؅tWhH_[^] U$SVW3ۋFTS%PSSv vH΅u Shᆳj)yuW SSSSWHtWWN=uJEPEPEPjW]E xH3fEEPYFV8] tW5 jSS Shᆳj* ؅tWhH_^[UUDC 3]U|SVWMOEPw ujhᆳj^ |utt jhᆳjVu jhᆳjNt,NNt jhᆳjuGXP PEPruPPEPM1_^[U eeEPEPEPh uExHtEU$S]V{tWwTuu uCxjjsps0s PswHuPhᆳj 8 3QVQQQs`QPHu Phᆳj } t SVY Et,j[EPE PjV]|HM SE PjVpH3SSSSVHtWV=uJE PEPEPjV] E xH3fEEPVYGW8]tVjSS Shᆳj S ؅tVhH_^[ UU 3]USVWyxM W-$]j)C0u(LFxtC0Lvw' hI"_^3[]UQQES@VWw؉uQčM \t69uEPO M Eu7EPM菁u븋M Eu_^3[US]V3{WL$vCHQD$ 3D$ {v KI ԔD$Cp KF8C0JF\$0Cx$CP$$$WVPK) L$sj 3WpHiWpH,\$t D$ Hx L$ u D$ F ~u L$| _^3[]UQQS]V{WuWw3ۉuQčM t%j uCEPMuɋu }F $CˈwuQ̃!MEt9tEPMuQčM ]{v CHljju vjX@ jju ECEG GjX@jju EEG G3WEujjWu Q]EujjWu -jXjWu 3AO xjQju k)3+tfHtYHt8Ht,HtHtRjvxxu F >nRM Eu莐GxXxX u vF >^jjH脃M hI_^3[USVuك~W\$ vFH3F0SGFx0CP%jWhIV$/jL$@u |$ \$$^\$ F >jHt$,̂jHt$0L$_^3[]USVuW~vFH軅3ۋF0FFx0GPajSISV$jjL$${|$8t/jHt$<"jHt$@M StDu L$h6D$(d$D$D$,D$QD$PD$$HL$L$ _^3[]UQQS3VCW9]u GXȍ9]tW|3V;uVVSu h$=K2jVVVPlHG;u2 tjMQj2V]upH_^[SV3S*t9^uC^[UES3HtQHtLEPSj&S]|H9]t8VukuSVžEPVj&S|H9^V趦Y^[]Uy0t]]USVWh9Kv4YYu PhᆳjoE3ۍEPhPudHtA9]t"WjuPzEF^ uF F u Shᆳj!jSS Shᆳj ؅tWkY_^[UQQSVW3SSEPuEEHMuM9]tFEPuWudHt<9]tuNDWEF^ t MWYYF F uShᆳj!W@YShᆳj jSS_^[9t1H3U} ᆳދEVFu HFE^] UVuqH @0^]UE xptQ\xpWtylBt!@P2j+upHG@P7j,upH_]SVCWwjYHt Ht3f3@fC+t6HtHuHCp +BvOCpBvOCpAvO$q_^[ULVj83EVP軻3@ EԉEȉEEEE܍EPVuE|YPutHu2S] WuVuepuȍKVuVpuԍK VuGpu܍K0Vu8puK@Vu)pusPjupVEPK@JSPK`MxfEfCxECtHtHt CpCpCp_[^UVt.}t(@VjhZSE3 9Fu^]WwhH7hH'gh'h_UQQS]VWt=u t6eeEPj+GYODOGDp2_^[UMjZ]U9tu1LH@3]VW39~vF tQF$G;~rf_^VNtAQFFt`&N^UVW3j 9~uYt u>"ؠYt unFGFxF~_^]UVWF 9FuLsjX3jZF  Q~YtFtPvWvΠ~jMYtU JO3NF臟Y_^3[]UEV@W0w=Fu 8>_F 3^]UEM @0胆M N3]US]VCECW4|3F9uvK |#F;uru >_F ^3[]UEV@W{u u>_F 3^]US]VCECW{3F9uvK { F;uru $>_F ^3[]U USVW3Fj3ۃzM_uBHMy u ^)t{t@ t8HHt0t2u U3@SF PHwj j_uUzruFHzUJ zE }#؉]yx+;}uu Ek3ۋ+CMK }#3@H# U #E E }3@+ÍXӋu U#]J# E3F _^[UVuWFHyN9Ixyϋyyyu .>_F 3^]US]VCECWjy3F9uvK Uy3F;uru >_F ^3[]UEV@gQQ$ u ]EjF uRPEP PMm3^UE@Vxu(M~jMm(M EPvM=qi=~M hIsjHj,uC=}M fE3fE EPzs$MEE "M V[sVY3^UE@Vxu(Mi}jM'M EPMp9M =~hIrjHjztfE3fE EPr3^US]VCM0W3a8vjU7iYuUWjHt{v}CHDwHtIHtAHuFjuEuP0tMEUu EF `j_3GWuEuPM PMn5~u v\EEF FCEF _^3[UQQEV@QQ$!u ]EF 3^UEV@QQ$u ]EjF sRPEPP&M3^UVuWFXP0Ht!FXu ΋TF >$u ?&F jHjQr_3^]UEjH xuVu &F ^3]UEj H xuVu &F ^3]UQQSVu W&]F C8vtI uC-^ECUm]E] ED{I3@F _^3[UEV@W0jwtnWP0Ht3G3u >_F 3^]UQQSVu W&]F C8-vtO t: t4X艺ECUm]E]7EDzt3@F _^3[UEH uuVu D&F ^3]UEjH vuVu &F ^3]UEjH vuVu &F ^3]UEjH vuVu &F ^3]UQQEV@:QQ$ u ]pEF 3^UQQSVuW~3ۋCSvtHOSut;Ort/N1Ir΋wru ΋^ >~~ttUOrttIOIo t=NI8oˋ-oVWRP} ϋG 7_?FH08QQ$,QQ$u ]bEF _^3[UEV@WTu ΋/>_F 3^]USVuW~EuFHaquE} '3AO F!;;)FjztFj@ȉE `tM 8EtVpMI pȋ+M E;}s~o=}@ET}u DG 7]FU]t"TEE]ESjHjmJFUtSM]ES]EG _^3[UE@oS3]UQQEV@QQ$u ]FEF 3^UEV@0l0vM ]3^]UQQEV@QQ$u ]EF 3^UES33VuCV^ +t-HtE EF FQE ^ B]W} ρ;wrw`F PF ^>_^[]USVWMHC} y3;~uCPSWVa>CPCPWPM>CPCPWV;>_^[]VNDfN4fN$^fU$SVuW3SF L$ bsuD$$Pu utxD$Pt$$D$IS\$ \$$\$(O|$vCϼuuD$PD$PSω\$ ytVtVL$L$ f Lx_^[]U}uEPu|HM EEAE `}u PuH USVWu ȅ] 3EEEC+EEPI;A;Auu hl2KE;CsmWh=K`j@P`PMgCjj4EPpMd;}uhh2Kh=K:`P,G;{rhp2KM M2_^[U$L$ Ra_^3[]UQQhYPMhu5L0HuM cM3UEV@0#)F05LH3^]USVuW~Et FgEv NIgSuH_^3[]UEV@WguPjHu ΋D>_F 3^]UE@gL3]U4S] VWhIˉt$$b5LH=Hj ׅtTj HuHjjHcWHu HjjP'bWHXjׅtWjHtWHtPL$6gD$(PL$=PL$(O_WHL$?_jׅjH=WHTL$kjjjW|H3H~CًhD$_F 3^]UQQVWh视YPMj}3fE@0%FhW0HM EP /MY_3^US]V{CWrp$F8C0$W 0$jF0Hu ΋=>_F ^3[]UQSWEPh:3CSh8=KjjhXHu!Vu &^ jHS `^_3[UEe@V0W$VMEBEBEB EnNuu`HEPjtEPEPEPfuM ljHy_M hI]MO[_3^UES@3VD$ I\$\$\$0WLB#FL$Q0S6Dx-|$v&ju D$PD$Pω\$эxL"SHjψL^M hI,]L${_^3[]UE@V0Wj(e΄t EP5)j et1MgEP5P]EM PiM0ZM hI\jHj&^_3^UtSVW}ًwL$ \$t$\xd$FF$tEGH$DD$Oj)q cu`D$D$ujK\$8Gj)p*t L$0 `D$,Gj)ptL$0@ `D$(GH{`x Gj)pΩu ]`D$$L$0 GHG`x Gj)p蚩u )`D$ L$0Gj)p ut,3fD$@Gj)p[#L$T,J( F0ftNj^auft$@D$ Gp FL$ Hft09~Mt mL$0|Gp J F\$ X0D$Gp ) FDXPҩYt)GCp  L$Fk XȉL$뵋D$\$ \$D$4D$ 9jjH[M hIZvL$XGj)pt L$dHxvL$hGj)0ާt P JvL$H|$wL$0T$,Qt$(L$0t$(j uPjjU_3^UEV@j 0_tu ()j_u ΄t 3@F &F 3^]UEV@j)0蠥tu Ƶ3@F .j*u ΄t 襵蘵&F 3^]USVW}L$GD$D$ PHD$ D$D$$D$GD$ 03Fuu $F 9t$u+u T$F SHjXrmGj)@ȉD$ 虤u L$&[D$Gj)@ȉD$ uu L$[D$Gj)HWtOj)IFu3CrGH ZD$ ~~r GHZۋ\$tjPt$t$$Q#|$ ~HG0eN <G0DN L$ u_^3[]US]VCL$ 0W΃Fuu 蘳&F CHYCHYD$CH YD$CHY{D$r CHYL$jWt$VP"}tj_C0^N t$1jWt$ t$( "C0N L$_^3[]UEV@0F*uu 聲&F 3^]UTSV5Hh3ShSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSEhSE։EEPEHuu 葱F 6EWt;DtG~u fF G_^3[U SVWEPHHPEPAE)EE})Eu]3jCSu *EEejESEPu ]莮MӰEeSESEPu ]hM議fG YujHjSDVuu }qF !GV3C;uu }J^ >_^3[UVu~Wu FHVVjJ2PtVPlVP#_3^]UEV@0/Fuu ˯&F 3^]UQEW3GxMr@HV~SES3V~F@0FgtEEC;|u N&F ^[3_U0SVW}MGEGpeNEEЋAEԋAE؋A EGp9N3ۋEEAEEAEA EG%Ut#Gj)0xuUOj)ITtEPM@EЉE@9EvjPM3EE}r GH7؃rLOj)y u9ϮiKAu 'K豚UPVu VuuSHu ΋ӭM>F LML_^3[Ut$t$`HD$Puuu ݬ&F `,3t$QčL$ 謩t5T$uD$PL$It$ʋjHj耳 D$PJPL$K_^3[]UOE ~r#NI2P0Ht FH2HEFNNI}NNEINMIuI N+VEYMxEPEPut7}u WuVu3Z]EVC HqY_^3[U SVuW~Mr#FH71P0Ht FH!1H؋FNNINSEPE}ujHVWPEHu ΋nuˁ с jF  H3_^[ULSVuًFW]MNEIsMNEIeMNEI ETM~EEr#NI.0P0Ht FH0HWEP~r FHL~FHLEE~rFHL3ɋFQHLPMu;uEE;EE+EP+u@VEYYpEP2ɍEPM Wˉu] E(U3ɋ؉E܋EM E;MljEE }};uEPMTjjSE 9 +jY}t}+}+}jjjSΔR3B}V >t}} }+}RRjS蜔 >}F uUE 4uDM uuʉuu؉M unYM u"ʤUԃ#3@jC PHG_^3[UEjpP]UEjpP]U=LSW}_GVJ3x,GJe}GVJPh5LpHrdGpa F3ɋf9t#GpH F03Pj 5LpHv#Gp F03Pj 5LpH^_3[]UVuW~Fu*HIF0t jv褩0 jvŧ_3^]UVuWFjIPH[F~vFjHIPH~vFM pS_3^]UVW}GjCIPHѩvGM pJS_3^]UQVu~u FHHuF0 F0 2ҋN $3^]UEW@HjdY;wi QjH$Vu &3@jF PH3E^3_]UEjpPw]UEjpPb]UEVWjpPKu =L財>_F 3^]U ES@VًWGƙDžEi+iEPu3VVPVH~+PWHtVVWHu ΋>!VHPH#Du _F ^3[UEV@-GPHtjHPHCEEuM P3^]UE@SV0WxvFPVEPctejjjHujHPHWC;jEPWHuu >)jHPH!CWHu _F ^3[USVuW~EvFHFEV2zvEPVEPttjjjHujHPHBJjEPWHtuWHuu *>)jHPH=BWHu _F ^3[U$VWMXE@0EPvXuHu#PHPHAM hI+@B@ j0EP` uHPMnEPMM PMe=M]=_3^U8SVW}GDW؋J]yDM hI?ujSHA*E}DžEi+iEPM3QQPQHu jHP뒍GPOfYPMPSHj]WSuHtmExr@HCu?S;ԈY;u0SMCEPMM PIM_ jjH?M胸_^3[jHPUSVuًFWBVJ%NЋI%jPRWHu ΋gF u&jHPHo?>_^3[]UQVWHJjWC?M EuL_3^UVWD$PhHJjV>M D$ t$ K_3^]ULS]D$ CVD$ D$D$0W{Fj?0$<P3f$C pFh0$8P赒3f$:C HwAi$0vCH ZA$$D$PjH_^3[]UQQES@V0WjΉ}EnDuQjaDt%~ u3@u x}F Au j&3C^ jHSbE3C9XuSA.u ΋6^ >AMI@P.} ϋω_ 7j@uUPjH=_^3[UEV@M0Wxv$@PVuEPuu 蠙F ,SjjjH} jjW]- u;3SHPHF jEPSH3SuHPH3=єtu &j^ j;FSSS0cO>PHu ΅t"ԗ&j^ HPH: 貗^ _^3[]UQQSVW} jjW+ jjjH؉]u;3SHPH:SjSWĆHF Exv.@H=tjEPj hSEHu3SjSWf3@PPSWF єEɖE3AjQSWN $MI1vjjSu EHqv_^3[U\S]VCHWF _^3[UE@@ Hwp$wEh=Kgh>K`h>KYh >KRh0>KKh<>KDhP>K=hd>K6hl>K/h|>K(h>K!h>Kh>Kh>K h>Kh;KM I33]EEEEE$E+E2E9E@EGEENEUE\EUE M:r E:w3@3] UUVP3t(BP:tFPBVPt3@3^]UAPAPu]UAPAPur]U,SVWHPD$Pu} t$|$D$(P,HP|HF|$0uXG|$4xu&VVWShH}tj Y_^[]~d~j ^D$ PHD$ L$0iIL$4@D$D$$iI@D$D$PD$Pj V׋\tjjt$t$ hHj YUQQE MSVuƉEE3WB3] EM;s_FFu ;ur]t;]rҋkыk;]r;r +k;r+ ʉMEyjK_]E^[UQQE SVuƉEE]EEWE F3F3pK33pK33pK;ur} ;}r҉UEyjK_]E^[UHSVu WF~;‰MN ;Lj]}tVtN~ uEPE1MENF F~^ +>+^GCj]HSWPEHuEHuEPHuE˄tيUDŽt؄t^ ^] ]tVuh QPu RuSWjjVH؉Ej 3@3fEXQfEƍEPQQQuE(V5 H}M֋M̋EQUYjEPWS]juSuSHuHSHuj Ht WVY3_^[ USVMԉu EE~8LtP$H%L}} W}rGpvM1u} rGH 2E} r OI2؃} rJOI2tEGHw2$jY#EGHY2tujEPjj0(HuE+‹uu E+‹jdh,3VVEPHMQVuEPHG0F3PPP5LE+EPE+EPSuHuQhIuӍMQPLHGpuF3E+EVVV5L-jhjPhPQhxKVVVVhP=KLHHjPVHPPj@VHHjZVHVHkPP3PjPjjPPPhXPPPjHǙYPDH5pHjPj05L֋E+E3WWW5Lj+Qj+PhPW=Hh`=KhףLhdjhPjjh5L3QQQ5Lj2hj7E+E-PhPuhxKQjjLPj05Lj5LH_M(^3[ UUVu +y3ɋE2^;ȋE]UMMSV3WPEE]Љ}EE9Lt<L5Ht P։LLt P։L5L$HL}EP,HP|Hu ]rCH+/tCH/ErKI /tCH .ErKI.ErKI.EKI.twCH.}ȉMu)t PEt E}$#Eut Et 5Eu}Mu E++E}uE+E+EuEQjjPHVjuEPHC0F5H3PPP5LE+EPE+EPuuuQhIu֍MQPLHM܋E+M+E؃};3WWW5L}PQWWhPWhxKW֋KEЋqV3jZ QKYuVW3jjxHM HPjV:VCLY^_[]U}Vu QQðWSunY؋Ή^΄t"F F@P>PFyKYS=F@Pu6D [^]UVMKPjċO ntVP|$tkD$HPt$$0Hy|$tVPjh@Kjjyd$L$QL$LQVy|$tVPjh\@KjDVPt$v%Gj)plt3F\$$D$(PdHd$0d$4j XfD$(uD$"j(SEYt38L$QSt$WD$0d$0M D$(PD$(PLH3_^[]ULSVWًM 3hI|$D$(PdHuj XfD$(F|$0|$4ʉT$~s Wh?KWjzjPDYD$tW~vNqFuD$|$FpE@PSt$vQL$$DϋqyQPWWWV L$0D$HD$AD$AD$ A L$D$$ t$t$`HL?KL$~u/9|M DPM+Fj@ȉD$k$L$t3@D$D$HP 4jXD$D$HD$8AD$KVjxMEPEPQVVVWMtd M_^[UES@3VuW}E]ԉ]؉]܉]E]]9] 9]ujh4@KSjt-jX9F uËpuUEPΉoYy jSM3@Mf;uMUEt?PQu x&t f9uEuEujF3ZjZ 3 P(YthiCV0jZȉEуMˉMEt,ًEˋ@4F;r}E3ۃˉMtwu}jEZf9uKVLHM@ ff;uhI,HMEЍEЉFGjZx EtvAM;r}E E܋EEt EEE؍EPdHj ESPFMu }URURtSURURVhhKSj#3@Ph>KSP*_^[UQVuWt+hI}uuu Vt jqj_^Y]UU3VEEEt9BvBx uRu EuPj Ru EuPjMb^ U@USRVu 3ɉM܉MMMĉM3MEشIEfEW@ AEjG^f9pu f}tD@ PjoA3UB AGt.Ht$7u'BD@ PjomhtOGQM}밋Ej^fEEPMfu]U3ɉM f9p!j@fx3^jMQMQ0 EuU܃~ M u Dfx5tjAM ~ u*fxNu jEPE PEPh(/uMUaM܋E uEj@@^f;t-jYf;t%} j@^WEPE PEP3xJMEPU܋M jf9p^uDf9pt AM @ PjnL3M`M M蚃_^[ VjZ uj M uj@ u3^3@^UVu W;wvwM, MVjWE_^]VW~ tNytQ~F ~tF NytQ~F _^USVjF [9FuM jX;r3ɉF W Q"~YtFtPvW"v_A~_S\(Yt M 3ҋNFF^[]UVuqffM H^]US]VWICFtZjZ;rЉV 3ɋjZ Q'3YF9~v5j 'YtK43ɋF G;~rf f_^[]UVuWFGFGF G FPO F PO _^]U$SV3W}C9_Gj0t ~ u63eVM;IjMjM;jSESPzMJNEAEAEA MEuu`H@KMtM 3SM;}VSEjP MPEF؋OE MMt]3MM`]_^[UhS3Vu W}ًEEGỦUE]Uf9Pu8,uuVW6MOjZj3UZf9PjUZGENEOEGEHE@M0quEPEPEP}hIMuEhPEP-uEPEPEPuGjNYf9HeGjOH MYf9Hu0Wj6uqM̋[űu EjEPVW-M2yGjOZf9PdAM̉UGjNBYUUf9HG!M3E9E~#ME@E;E|judYYWfxA AEjNH MYf9HMjEHWEP6j53ɉEAE;~'كWdj6S C;]|ދ]M3E9E~#M!E@E;E|juYYUUe;WGEAEf;Eu UE܋UjNYf;t5jGYf;t-jOYf;t jHYf;tj@Yf;u}t$jYf;tMEEBUE;WrE~3}jPuVW*1VE3ɉM;GsojZGE@f;tUf;EtEf;Et?f;Et6f;Et0f;Eut3f;Eu'M܍U MjZt LIAMC;_r]jEPVW*MEP LM O@f;Et3f;Eu~Bj3Zf9PjZG@ PRMMjX_^[ uj}uhuj~uj{uuM@ Ph먋Gʋ@ PjXPujnu@ PhzEG@ Pt hZhPUE8@SVW} fxt@ Pjr`39tT譂PM#}t(}t"EԋM@f M\WMTW뼍MJWMBW39uE@@ PhzU3Pp24t3@f9xutHtHtHtHuхt IʅuAF_^[ U@SV33MFWMԉ]ԉ]܉u]]uVMuuVMĉu]E W} ]S3f9puu_8uZA@ItHHHAE Cfx50MVuԋuECj3Zf9PECM0詘CfxAuAjEPWS'uEPE PEP} uEhPEPEE tKHt:HuQEPMCMXU3@EEE E EPM/ EPM"nS@f;Et0f@uOAj3Zf9PC@ PhMMTMT_^[ jjnԋ@ PjXPƋCD@ PhUSVuWF@3jA[Mf9Xu_eejEPEPMV_&xNEf9Xt@ PjrjM&T_^[M}M Te~ߍ`>tE8t 8t ~8uE~@M @9]|jh|ULSV33W@M]]]]Eƅu EHEEEEPH}ЉU}IJ3f9pu uŋHt#Ht HHuK맅uIEMM딅u8]uA3EEf9Hu8u jUYEPEPRH}UME@fxu0EE"CE@@ Pjr<}t&EtEP`资}EuEEjheM!RMR_^[US3ɋVMWM]̉EEMu }3EԉE܉EĉEGE 3f9Au7t"HHtHt A PjjYB3AA PjnM= LMu E uEj jPtOjZj3UZf9PjUZDENEOEGE@EHEM0躓uEPEPEP}uPMj.M/GM0ujEPEPEPEuAhIMjuЍEPEP4jEPEPEP}EEuhPEPEEċGjNYf9H"3E}GjOYx f9Hu3u3P6uLMԋOuԋu EjEPVu!%M E@jOZf9PAMԉUEjN@BYUUf9H<Mz3E9E~#M|E@E;E|3PEP5YYf}WfxAA}MB Eth_3Ћj^f9pu HG@GtHttHuJBAuGj@[f9X]kGj[f9X]uTjNXjMf9BEHWEP63P3ɉEAE;~(كW3P6SkC;]|݋]̍M"3E9E~#M$BE@E;E|3PEPYY%MM3;Oj^Gj3E@ZEf;u MU hMt  L:EjNZf;t.jGZf;t&jOZf;tjHZf;tj@Zf;utf;tKCAM;Or]̋u E~3}jPEPVW Q3ȋEM;GsojZGE@f;tUf;EtEf;Et?f;Et6f;Et0f;Eut3f;Eu'MU nMjZt LIAMF;wru jEPVWF3 L}u MEPO@f;Et7f;EBj3Zf9PjZG@ PRMKMM_^[ G@ PjyWj}WhWj~Wj{uuujnuGʋ@ PjXP뉋G@ PhrU|SVW3A3ۉMMM]]]g}M3@EEԉEċA]؉]]ȉ]Љ]]@jZEf9Pu @ Pjnu jHEEEPEPQӉUPH|؅IK3f9pu uҋ8HtHtH+Hu&J멅u8UuA3f9pu EEu 8uAjYEEf9HEjEPEPS Cu3ɋf9HuF8uAjEPEPFSωuUȍMutUM購u*uU؍M9uCfx@uFuju ECjYf9Hufu U}UEEB6ENut@EP`{}E tM804C@@ PjrMEIEjhMHMHMHMHMH_^[UeeSVW} ElPEMlHjPWugxu$E@D@ PhY_^[UpSV3W}37@ٍMEPIuuuuĉủEЉuuEuԉu܉EEIuR} EEEAMQfxHt7MMQjGYf9Hu EIj5Yf9HuEjGDYf9HMuEPWQc`Ej5Zf9PuAUJM AE8fyNjMtxM DfxOuMCMЃV#MjEP+_MEFMuME@jYf9HMEPEPuEPuxMEPMM*FMAEuԋ@f;Ef;Eu BLj5Zf;@h(AKQMEMEMEM*E@j5DYf9HtME3FjuMBMЃj#MjEP]MM]E‹E@jYf9HtVHjdM0EM(EM EM3 jEPWRE@jYf9Ht@ Pjr}jAXf;t|EPEPuEPV&xaǃRtMHt0HtHtEPM蠾(EPM衷4EPMu EPMeEPM EPML]EPMEPuEPMDMDMDMs_^[ UPSVuW} VMjH[f9X]]uD@ PjpVMk}3j@EG[@f;EuAf;EuI f;utxB׋} MREPWEPuĉuEaycUj@[f9XuIjGXLPM j M]tTfE3jMfEMYM܉EEP )uEWPj\ME ejMptOMj4 uE܋4EPMPMEPuEWPj@H3 jMM苩M̋EAEAEA MEuu`H !LuPE~LfE3jMfEEM܉EEP uEWPj{[ME UMű&2t?Mj4 eMͨMű EPuEWPj_^]UUBABAB A BA]UU EABABA B A]3AAA IV EKo(v"Y^VEK1v Y^V)tF^øC^UVEtVY^]UVEtVY^]U38ESd$ VW}ًOD$+ȉ\$,q肚ND$`AD$dAD$hA L$OD$l+‹L$|T$;t)u 2&F jHj<3D$u ;'fF >};;;u ]o'EF Qu ;Q'F 뙋u ;[9'^]F >M j XfEEEP赘{t sY_^[FFFF^FxF.FOFFFF^F^FFFFUSVuW} 3ۋΉ_xv6,HjjjjjhDKnE ;Fs~MF _u !&F 3^]U\SVW3h@\$$t$(Yt ƍHD$EL$@pND$8AD$&F _3^]UES@V0ًbF0Huuu RW3t8tG;r;uEP 0u G_F ^3[]USVu3ۃ~Wv-FHˢuu f!Sj_FH諢؋Ne1莀Vu SBABAB A EP;u"&juF H_^3[]US]VsWj u'u 3@jF P&HͻL$ {r6Nj)Su(NNt$ yu hjF j뫋Cd$pL$GjL$u!L$蕾L$p#D$t$Cx u3jQt$D$u PuYPHL$_^3[]US]VsW>Mj wu*u U3C3^ >WHS趺{v3M}}}ejM3CuM貽MpA]uE@x uύEPEPEP!tu E΅uU^ >WHuEF M" u?3u F >_^3[UEV@W0j Qu$u &3@jF PH蓹"~ u>3u  LF >_3^]US]VsWj u'u 3@jF P&H$L$ {r6N j)u(N 8Nt$ yu jF j뫋Cd$pL$jL$Wu!L$L$pzD$t$CPx u3t$ D$ju RP9sjPHcL$._^3[]UEj H վuVu &F ^3]UES@V0W3ۋΈ]|FMQUMYu'u F SHjƷ%8] uSjH] HufhDKMFQMftujjH1jHj.jHjI#C Mh0jPHjHj#C t^jVHu5PHPHjHjɶ#C V Hu yF _^3[UQES@V0W3ۋΈ]zFMQUKLu Y΄u*3@SF PH@. 8]tEEF yjK F _^3[U8S] VuWFˉE#33AEEK ;vFHEEtWN tHF0yFxt3E@0yNE PUaK} YujEHP3VhHȉME+(H2EPQHjjSVjVSHuȋ}̋؃jjju C 3{uЋ}ԋ؃jXPjju C 3{u؋}܋؃pjjju C 3{u}؃Djjju C 3{u}؃jjju C 3{nu}؃C 3{zj(EPQlHuVHjXjjSVjVSu܋gjjjSG 7u؋qgG 7u HVjHv_^3[USVWL$<3VjD$ EKt$$t$(t$,D$p,HD$hPWH]$P$P$PD$XP$P$P$P9st$C0vF0$PYYu?$PL$,nD$(Pt$tL$\+PL$ L$XgL$(^D$hPWHj^?W H|$ ] jGPjSD3PPjPSw$3@F >D$t$D$jVjjS@L$$ QNjVjjSD$$ L$(D$(yjK\$(D$(D$F t$Ft$OuL$}L$Oq pF3f90t'Gj)p uupvMK3rGHrEj<[SEVP(EЉEG]E@u0 "pFu]EEEEPu]xHtVYtSYu(U3ۋSHGW讫ux~ }tUẺp~uP3G}~ te3MEEt9u̍MZЉEEyjK]E]EF u H}t uHM_^3[US]VCW0"tu2NC0nvXTJ} uCHܭihhHl_^[]USVWjD^V3ۍD$tSP|$@V3@$f$E t$p\$\$ \$\$(\$\$$]t*CH D{D$(vKCH/CH{vECH CH %D$E tE {vCHujX9CvCHǬf$tD$$C0mF} KD$qdmN KD$ qImN ǠKD$q.mN 謠{D$v,Kq mN 苠tVfY=Hjj׋3jZF QGYVVD$(d{D$v(CplF#t VYuk= Hjj׋3jZF QYPVD$(׋t$ |$4} t/KhI 茦KhII|KhIIlT$RL$L7jtZqˍL$H$oύL$H$"lpˉ$"t$2ۀ} D$8PD$tPVt$0t$(Qt$@t$,t$,t$8vt$YL$tAHut$ YL$ tAHut$YL$tAHut$Yt$ Yt$Yjt$4Pjjt$8jHt$YVYu=3ۋHSj謦SHPHm ubF t$< Ht*L$H)kD$@L$HD$LqD$HP}t D$8p7D$@D$@yjKu\$(D$(t$8F  HL$Hh_^3[]VW39~vF tQ F$G;~rf_^UVW3j 9~uEYt u>"+Yt uFGFxF~_^]USVjF [9FuM jX;r3ɉF W Q~YtFtPvWHv~_SYt M 3ҋNFF^[]UVF 9FuP jX;rW3jZF  QG~YtFtPvWv~_jYtu3ҋNFF^]VtF^ø+F^3U\$$SVuW^L$H转L$(贬L$8諬L$X袬F0 hF0詢D$HPD$-L$L$D$,PD$PD$$3V PVhIVt$lQHtIVPHf3HVGW耗u J&|$~ t$$H|$ Gp^[FhFK0YGYup <[F0EGYp [F8E@p[FSWj3S0t$ HT$SPHu pZFh0FK0YGYp ZF0EGYp xZF8E@pcZFSW3GW3S0t$ HaT$SPHu ~ ;pZFh@FK0?YGYp YF3ɋ@D$jZD$  QFYOD$q YL$Vt$AQYL$3NtfpXFhpFK0YGYu+H 蔔D$ GT$$pXXjL$$Qj zp@XFhFK0lYYu5GH zW؋rz XV6zPSj3S2u &F t$ 5$Hփ|$tt$֍L$P苏L$0肏L$@y_^3[]V 39F^V~u hFKHthFKPHF^UMSVWuu`Hu Q&EPM2$EK׋MtWM)!Lx0t,EKM趯TEKM衯`EKM茯EKMwEKMbuoEKMQu^EKM@uBEKM/u1EKMu FKM u37E*EEE EM΍_^[U(SV3ɍEPQQQEPPQV]EH= EMQPjPV HMu$H3ۍM]]tS]SPVM PV H]uE9Et uH3ɍEPQQQEPPQVEH=EK^[Ã}t uH2UMSVW6~M .~M&~3}TIr[WM"j\^f90uJjM"f90u;jWMrSMuuMVWEP*FPWM}rM}SMHuuM VWEP*EM+HPFPEP*MS&M֋_^[]UVWj^9wswMuOV+QMWW*E_^]US] VWhIUzvJ ^EE3F9rvJIBE E >Stz}tVSRu SRSE } uBMu֋SEE-YPSV} ϋg}G t$u莳YSHjjQcRuMEPeSHj8_^3[UEV@QQE$VPWQčM tEPu 3@F 3^]UhLDhZDh#Du ur]U Vu 6u QčM _tB@EEyjK]EED{EPM 萆u 붋EM E ^U SVWًM hI虊uF]~vNIE E ~vNI˙EEEQQ$WEP}QčM uU} tju U} u UE}uDM"M ~q׋p8ujWMY~WbYM EP_'M&jHu}jHjPuEPjHj_^3[UVW}QAtBtP;u;NuVQv'N_^]UVM;NsF^]UVuWN pN pu ΋/>_F 3^]UQSVuWFEpVE {pJ؃VxExv HI?;yx+;~+M Vw^MVQP 3_^[U$ES@VWt$ oU؋Bou!M hIWHjwljY9JrJI虌jY3F|~3F;tu'ǙtM hI薇T$ jjH뜃;u;Ǚ+‹VL$$$L$ VjS{M D$ P$L$ 跄W_Y3ɉT$ ~+CD [;|Ǚ+‹VL$$J$L$ Vt$jVy{M D$ P$VuYWL$$7VWQSL$,WL$$D$PD$$PuzM D$P4$L$L$ _^3[]UEV@0LND$AD$ AD$A L$D$\M D$P#L$莃3^]USVW}G0KG^pKv3r%GH虊x~3u V_v PVNu ΋>_F ^3[]USVWM hIs]j{菍T3F{v OVwu KV wSV w;v V|w9sv Jԉ3;{v CH 赉3EtOtJM #CVjj0聉PM~F;rًM EPI"M+ƉE@P谫Y3ɉE;s5+ƉEEECVjj02M1F;r܋EM}u 27M Vu跫V豫YYjHj苅_^3[UeEEES@V0WE3rIFEE@p\IFuEFHHHthHtSHt?HFHGE&u !3@jF PHFHHExɋFH EtFH؅x~3uEuupuS0N]u;^u uD3@&F 43@F C_^3[UES@V0WWHFu 8&3C^ ft"PrYtfu^ _^3[]UES@V0WGFu 8&3C^ ft"PHtfun^ _^3[]UES@V0WGFu 8<&3C^ ft"PHtfu^ _^3[]UES@V0W7GFu 8&3C^ ft"PdYtfu^ _^3[]UEV@W0 u >_F 3^]UEV@W0 u Q>_F 3^]UES@V0WwFFu 8&3C^ ft"PHtfu^ _^3[]UES@V0WFFu XΉE3F >tMWfY%tG;r3@F _^3[]UES@V0WEFu 8S&3C^ ft"PHtfu%^ _^3[]UES@V0WNEFu 8&3C^ ft"PYtfu^ _^3[]UMSVW}]C0DFpCHx ;~C0DWjvM)M EPMc|_^3[UEV@W0{DFu x>_F 3^]UEV@0DDNEAEAEA MEnuu,HM EPM{3^U4SVWL$0m]C0CFL$ pD$cCpCFD$Cp΄tt讂NxYD$\$H;KwGVjSL$,|$WL$$OC++P1PSL$<D$0PL$$M hIv}j! CF3D$9puM hIR}VjH~w{t$rCH D${rKIx~3t$L$$苌D$Vt$L$(Pt$(jPH?M D$ PyL$ ?zL$06z_^3[]UVW}G0CBvL$ vv(GH=uVL$$L$ L$@8hFKL$4|D$0PL$DL$0yVL$D3L$0D$It$t$t$:t$ jD$PL$HtD$0PVL$HD$0PL$͋t$Nx|$4L$$NyL$0 yL$L$@;M D$ P2L$ x_3^]US]VCW0 AFMx舅CH ؅x$;~ߋE@0@S+WvMEM EPMx_^3[UEV@0@ND$AD$ AD$A L$D$(M D$PXL$x3^]U$SVuWFHJN؋1"@VB rD$B L$VL$$t$D$ uA3t2WL$fPuWL$PL$$sG;r΍D$ tItE3tWL$ ftG;r+VWD$PL$,D$ PL$t$tHtDVL$ ftNuFPjD$PL$,D$ PL$t$tct_jjL$( ]23tFD$ v&Gj)puP}؋D$ D$ X;XvXvGj)pu }3;*uC+SL$$SVt$L$,PvGH |3tbt]Sju j3 t$ Vjju L$ V 0$7t$ FG t$ ;rL$D$PD$$PuSI\$Sju j3 t$ t_F 3^]UVu &EF @M QFwPtE F 3^]UQEM@QMQ wPt!Vu EuF 踙Y^3UQEV@MQMQvPtuM quwYjHjRsM hIq3^U8ES@VpWM3jΉ}y΄tE3PCZJ'j[7NE؋AE܋AEA EM؋EAEAEA Et M؃ntMn]EPu%u `3@WF >PHvr-EM@QuPu ΋"3@F >3M'n_^[UEV@WH0XuPhIKuPu ΋>_F 3^]UVW}Gp5FjGQuPu ΋>_F 3^]UMj yXvAtx~j XL3]US]W{%LhIDLj tCV0b5vDL^vCH^tLL_3[]U4Ee@SVpWj}w΄tE3PC$H'j[4NE܋AEAEA EM܋EAEAEA Et M܃jltM]lEPŽu$u -&3@jF PHAp+EM@QhsPu ΋3@F >Mk_^3[US]W{%LhITL tCV03vTLe^vCHr?LLa_3[]UE3Axv @rQ]U=LVtO=LuFExv"@0c3hjvdL hIdL5 Lw$jHjou &F 3^]Ud$S] VW{L$t$t$tC02FOfD$v KIqvKIqD$v KI qD$M}\$3+tIu/Rt$VSjPt$VSRLϋ7G UquT$PjHnSY_^3[] U$S]VCW03{Cp1vW 3CS2d$0EL$@pUjL$tL$tSPpjsuL$ru2~L$u5L$ uD$ PVgu VpL$ hHKL$tD$PMHKL$t%D$P6MD$G HKL$ƄtE@p+vL$N{HKL$薄t-EL$(@QHjPhMt:D$(P_F 3^]U$SVWuى\$ouu '3G3GWD$Pmju <jWV'VD$3SD$0WD$4PV\$D|$H舿L$ D$WD$$WD$(PV\$8|$<_L$ D$+D$jD$$WD$(PV\$8|$<1L$ uD$+D$jD$$WD$(PV\$8|$<L$ G >T$ 3ۉ~ SHWQd_^3[]UVM hIbu1ujHjdEL$lD$PiujHjc M D$PL$_3^]UVuuu w&F  jyj3^]U4SVW}W\$vu'u .&3@jF PHBc*L$ kGp G'ND$AD$AD$A L$D$Qt$t$`HhIL$4軼 D$0P^Vr IKL$t jjhs(IKL$t PHIKL$bt(GL$ pQHePePwPvXIKL$(tjjh23pH|IKL$tBGHHePPu ΄t̾3@F 躾&F IKL$~tjjMIKL$~t jjtJL$y~t$GHdOIduPVjRIKL$C~t P"IKL$%~t.GHmdOI`duPVjO\HKL$}t3GH-dD$ PujjNM D$ PIKL$}t:Gpx$vcPVLu ΋^F >QJKL$T}tGp$vK&u T$ &3@jF PH.`L$0L$\L$ [_^3[]USVuW~V]jEP es]+] FHb؃s}+} FHbNj)A ȉE 'tEM bNj)qΉE tEbMWSPu fu &F _^3[USVuVuu ׻&F a~Wr5FHbt&8Fp "Wv$8Fp "WvԿ_^3[]UQVuWVEt;~vFHatEFp o"uvuu &F _3^UVuuu ֺ&F  jd3^]UfGD$p !ND$AD$AD$ A L$D$$Lt$t$`HhIL$< D$8PPrJKL$yt+jjh3pHu ǹF >@HKL$ytGp j8JKL$ytGp jRLJKL$qytGp v[Nn\JKL$@ytGpl jv>N? IKL$ytGp< vP\HKL$xt1GHiPD$,PRM D$D$(PHIKL$xtGpD$(PvS뺺,HKL$oxtGpvSmtJL$AxtGpmvSELHKL$xtGpBjvLu ޷&F D$uT$jjHZL$8请L$VL$(V_^3[]UUV񃦘J XtLR蠵j輷)yjPHxZu B&F 3^]UDS]VC3AWD$ 3L$jHt$n_^3[]UVu}m)yjPHWTu !&F WHu ΋>F _3^]UVuj3)yjPHSu 蹰&F W3^]UVu趮jҰ'yjPHSu X&F 3^]UQSVW}Wf3CS耰y$jPHPHSREPSHPEP )E)EE)E3jFVu CE3WEVEPu }uMĮEE3@PPEEPu }WM蜮2ҋ_^3[UVu説jƮ&jyPjH~QM hIO0L$ZT$ 4M D$PdL$*M3^]U$SVWu(} '3CSΉ_ 2jPL$ Q0HtjjSWAD$4+D$, 3VD$SD$PWt$(\$,/L$sD$,+D$$SD$SD$PWt$(\$,L$FjSHaP_^3[]UVuPjl&jyPjH$Pu &u W8֬>_F 3^]U$SVWu3CS.y3WP3WSHOu |^ >3WD$PTu jSV@D$ D$ WSD$(PV|$8\$<L$ 'D$SD$$SD$(PV|$8\$<躩L$ D$+D$jD$$SD$(PV|$8\$<茩L$ ЫD$+D$jD$$SD$(PV|$8\$<^L$ 被_^3[]UQQVu軩j׫)yjPHNu ]F ;EP0HHEEyjKu ]"EF 3^USVWu3C.SK%jyPSHNu Ϊ&Y0V8Htj_V4HtH;uVHtVHt u r>_^ ^3[]UVu脨j蠪"yjPH\MM hIKI0/u8L$U D$P YM D$P)L$H3^]UVuj "yjPHLM hI'K/L$ZUD$PERM D$PL$tH3^]UVuzj薩)yjPHRLu &F  03^]USVWhqYPL$eh :KD$MJhI}Gu ǃ;G0vvGpv 3V袨y)VPHaKu +&F D$jGPju |$$(D$;|wht$D00H3WVjWu L$QjVjWu L1n7t$FG t$;t$~L$_^3[]U$SVuWFhىEoYPM3Vˉ}Aj]y-WPHJPE Huuu ǦF > j_}9}VHȅ3IEMhhuPVHE@t Fu8E@t FW0PuVtE@E;EwIu}둋}u;}uuVHEuHutEG};};uu ֥&F 1ujuhVxH2ҋMS_^3[Vjh5KHjhhPxH3^Vjhhjh5KHPxH^3^U$SVW}W_\$6jR,yjPHHu ؤ&F j0DH@D$ tjjPLrGj)XTu J\$(+\$ |$rGj)x'u J|$,+|$$Ej)@@ȉD$ tD$ L$JD$Ej)HA ȉD$ ͓tD$$ L$TJ|$D$ EHI7JD$tv~d~j XD$T$ L$$T$L$9T$u 9L$ uWSQRNT$ L$QL$QL$jPt8WSt$t$$YMj2YD$WSt$t$6Mu 8+F >_^3[]USVW}W:3CST'3yWPH Fu ע^ >O0ކtu 赢&^ ,0GHI3jWWWW;ujjVH_^3[]USVW}W蛠3CS赢%yjPHqEu ;&^ AGHH@uSAujyIP0H*_^3[]USVuWFH9HFH.HVψ]j )yjPHDu 葡&F Gj0VDHrt3PjVH PjVHjujVH_^3[]UVuQEPEHקjdž]N@&M PrQ3^]UVuYQEPEHjdžT]N@ΧM PQ3^]UVuQEPEH'jdž\N@vM PP3^]UVuQEPEHϦjdž\N@M PjP3^]SVWj"yjQHB+H3B;|9tB;~3_^[3@UVW}W蚝uGHEiH_^]UVW3j~~gYt uj>_^]UVuWFPOFGFGFGF G _^]UVEtVgY^]VpRVgY^VtQ`VgY^UQSW} ً~ uuuWPľYPEPE Pu Ft^Vj$fYt NI3KtEu NPEFEFEFEF E PK,LZ^_[UQQSVWj$M|fYt KzI3ۋ}u \PK]NM;CcECEC EP,Y_^[UQS] V{DWE t sDHjHjZVHV3V H}M1MVu VjjPPQǙ0uVVVPDHu jWj0VpHE$u1t-jPPPP3HE$utjjhBVpHjSu{D P_^[Y] U졜LS]Wjjh0pHu 9E |.L t uj0DHuO}GVs)L t#uj0DHu F;5L~N; Ljjh0pHC;~} L^uMjjh0pH)j0DH PLj0H_[]UE(ujX}M Vu΋U$uփ}0}2nSW}3f9t^SQuRQuuPShKKSu7@u t8WSpHhgPӅu-WHt"u0Phg6Ӆu6$H2_[^],=0Lu fUQ}SVWu2u(],U F#u(C#],uЋM$uȋ} fEffEfEffu5jbYtL L 1M3ɋEWWuN?C=0Lu fPV5Hj7ցSj7ְ_^[Y](UE(S2@#E(VW PPtÃM,ujQu}u$u uuPuhJKQWr>u u2-tjuh7pH=0Lu f_^[](UE(ujXuV POM,jA#M,Quu$u uuPuhJKQu=u u2"jHFL=0Lu f^](UE(SVW;uB PNU,;uЋM ;uE$;ujQu3PQuuVShJKRuE=} ȉu29Ef9t5pHPShCQSShN790Lu f_^[](UQ}VWu=u} HG 2_^EPEPu(L?tߋMLuEL<t<t<t<ty uH} MG LG A  wƇkUE(SVW;ujX PlMU,ؿ;u׋E ;uM$;ujYjQuQPuuSjhKKRu;u u2?MӀjUPYYEPjh6pH=0Luf_^[(UE(u0SVt PLE,uM uU$u3CSQuRQuuVuhIPu:u u2(PXHPPh6pH=0Luf^[](UE(@#E(SV P LM,U A#M,uE$u3CSQuPRuuVuhJKQuR:u u2jHFL=0Luf^[](UE(SVWu PsKM,] A#M,uj [}$uj _3RQuRRuuPRhxKQu9u tSff}33Cf9ttEfEf̍E0PQWVLu6$H2ۍM0_^[]8SPPPP6H=0LufUE(uSVt P[JE,uËM uU$ujZjQuRQuuVuhIPu8M u2=0Luf^[](UE(@S#E(VW PIM,Aً#M,}3@PQuu$u uuSuhxKQW+8u u2@tMQP|HE+EG`E+EGdjHFL3@=0Luf_^[(UE(SVW;u P&IM,;u} ;u]$;u3BRQu3SWuuPVhJKQuq7ЋE u2TMf91t%QV5pHhR֋E jjh0֋E 3=0Lu 3AfVSWuu0H3@_^[](U, ^E(SVWE;uj X PHH],;u 3@tEE ;uM$;ujQuQPuuRhIh,LKSu6u u2}tjjh6PpHS3Sh66pHE9tjSSSSS6HEE]pHEEh<LEPP=tfPJqE($HLKPMqYYPjhW6ӹE;~ME(3fEEPGWha6}끃3ff@=0Luf_^[(UH }\SVWEPEPu(L7u2LMu MELpH8~4L3PPhPPhWPӋUf Lj W EfDHj4EEjP{p jjhWӋMЋEfM LEE 3Fu~E؃eEЋEEh<LEPPU;EPjhMWӉEh<LEPP;u;u}uftEPuhtWӅEtEPjhWWӍp ;~juhW;ƋuPVhWuFufEPuhW)E t LEj 1uA_^[U4SVWj,EjPE0n }u;uu!\HP6TH} EPEPu(LE5MLM0LP } L t EPjuERHteE?t[7HtOH؅tCEeEEE܍EPjuE7]H~:u6M,A#M,3WQuu$u uuSWhKKQu*-u u2EWW=pHhPthdjh6jj h63@=0Luf_^[](UVut2E(@#E(S @P>M,A#M,ЋE uÉE W}$ujQuWPuuRhIhKKQVY,] u2Pj Wu uujPHƆ=0Lu f_[^](UVuu2ES3f9tPEEEEPE h>QpHM Ɔf<8^8t PV(Lv=8^8t jS6@H2[^UE(SV2Wuj7X P<3@t3ʊ؋E,u @#E,uU$ujQuRVuuuQhIhLKPV*} u239tjQQQQQPHt!j7ƇDH Pj7H~8t1^E(PE,Pu(L,u(u,t Su,3@=0Luf_^[](UxESVWPEPu(Lv,u2ML3ɋ9t⋃Ey9| E'MMxE苃xEEE܋Ej EYu̍}󥋃EtEMLuH4Mu E@E5pH} EPjh2QjjGEhPG4fG_^[UEujX uSVWP@:u3SQuSSSSPShKKSV(ubwYoMQMQP(L +t_ML;uLULu6M 5pH9LSPhiWA4hSheWְ W$H2_^[]UQQEPEPu(L*u3uMLuu 0pHUVu>t~uhFj6HF^]U8EPEPu(L*u2ML Ht\xڃ ~S t3uˍEPjuE0Eq HtM E܉'I t~~ ~ IE UQQEPEPu(Lc)u&MLu UESVWPEPu(L)u E ML]  31Mu g +tlHt9WWhpWWhVpH؃W=pHShV3j@Z QPIYVShu ׋'WWhGVpH؃W=pHShIV3j@Z QHYVShH3WW=pHh V׀}lQPh<VDžl׋E  =+3Wj h V;pH\}EEtFh WHY؍EPWh>VE]EpHtSHYEPWh>VpHEq HhG}uY<} Dž<0Pt?`3WuDž@v DždHu u ;bE mjuDž@v HW9GYH$@@ t t !;Ajq43Eԉ;DH}EEEt"h FuY؍EPWh>v4ruEPWh>v4pHMغUt Ht  t N C( ~SEP3WhVpHt,jEMQMQMQhJKVHH;3}WWtGjVpHp3jZ QEYVPu E0Hu u;dEohVpHWLWWjVpHx3jZ Q=EYWVu 0HqpjΉu&΄tRF3ɋ@j@Z QDY΋mN]q]SNQǠYZ" jq4DHj4E 3EWP]Eu xpPjhSv4DžppHEIE tE}t?EPWhKv4EEpHE Hh DY3f;UEESpHu[Y+ȉMS[Y Cf<Lf3QfADHЉEE@;EEEPWhKv4U|pHBjjh V5pHj43EWP[ EEPWhKu E#E3WWhVpH3_^[ UEPEPu(L"u3qMLV3E+tCHt8HuOEPuu QpHUM UM U M M$Eu(uuuu QpH^$UQQEPEPu(Ln!u3=LVut3!u $/LE3@^ UQQVEPEPu(L !t1MLuE Pp)ju>-3M x^U ESVWPEPu(L u3MLMELM 87u] H|wHË] tx~tHt-uE zjPGHcjjw4@H'} Su jh} =u jh VpHE E  jPGH 5Hj7j77HtNAt3t~#jVDH PjVHjS_Hw@] u;u jPGHU)SjhV5pHSjh&ujWu*=Lt } u3@_^[U ESVWPEPu(Lu3 MLMELM 87ÃtmxtOt>uE jjw4GL@H=Ltt tu{yu jhu jh  u jh$VpH믃tt+t)~jVDH PjVHE jWuGLp)d3@_^[UQQEPEPu(Lgu3!LMfE Qf3@U!ASVWEPE3Pu(Luuuuu3MLMLU;t6<tv<vHMtDf91t?EEEEECEXENEKMA4F$FE uNPjuWpHtVPuWpHEjSP (#E E f; <LtfuPDHpHVVuE *pHh<LE PP tPVuW׋EPjuWӃVPuWVu gYb`PhWpHtu gYB`Pjhu gY*`CLFtf91t u jhu WHh?Bh@BhWpHEM jjUYYEPVhWpH] uj EVPT ] h<LE PPt6fEEtEPVh`WpHqFSHSYtS=SfDCYf;<LCE EEPVh`G} [4j4EVPpSE @8PjhSSDž8pHE} h<LE PPt;fEEutEPuhtSpHFWgRYtW\RfDGYf;<LbE EEPuuhtSaCE PVh?s4Dž0E (PPh=3GpHEWV0@Hh9YPPVuDžP0s DžTtDžxHtAXu5E tPPVus HtE0VE2pHEMUEtEtЍEPWh?VUMpHC;] ~EPVHWWEPVLHu$HIE@A0jVDHyUh WWWu WxHE PWhVpH9{dt sdH9{ht sh$HE Cd{h}uV} uPh 3WWju WxHE PjhVpH9{dt sdH9{ht sh$H{dkjEPEPuu HT9}=$HtEuEuE u jhVpH{dt sdH{htsh׃cdE ChPEPEPuu H#jEPEPju H9}u 9}} uEWWhVE }pH?s4V(LuE EEEPjhSVEpHEb LEE H8@yˍA=w fLML8Y:u S0Q3@_^[UD$SVWPD$(Pu(L u3LT$$L$] D$ L3t$8D$D$yދ%D$(tQRD$tjVVVVVt$4HD$D$9   I  G$$#DŽ$DŽ$$t $$PVh?w4pHtwjhw4pH9t$(w4(LPt$(xwj h w4D$,PVt$D$80w D$@HV MyjXt9t$(t D$8tuD$8D$,PVt$w HtVt$&D$,PVt$w HtD$8tVQw HD$ 0E|L D$,D$(0D$0T$HD$4E D$L (L L yPt4yXt.qP$HLhI`PLTŚ~PpHD$0D$D$4uLL$Ej5|LjQQQQ@ PjhJKjH~PD$(Pjh3WӍD$(Pjh2Wu NT13@9~PtvP$H|LEWRW6QQQQ@ PWhJKjHt`pHD$(Pjh2Wu NT~P这D$P,HP|Ht$ jhWӃ}duuh!WQ3_^[]USVu كt9W}WCpPV5utQO'_^[]UQQLVEWE3PMuA}QčM0Wt;E99tEPMI9pupHEPL3F_^UEwf$AFh]hVhOhHhAh:h3h,h%hhhh jhjHP0H]IFF&FFFF&FF&FFFFF FFF"FU4=LSVWtu uuF^ȃL$ȃD$HL$$tjPS@H} } LujPwLS@HHD$ ujHjD$HwH;E9L;E|/;E*;5L"W8HtWlHt =L5L3_@^U S] VW EE PL}0HL3ELUj_9=LLtxA;Bup ugȉ L Lu3L0$H3@]U LW}t W(Lȃu2LV0u@H9t2jV(LtE jxEh_F|EE%LLlLpL6\H}Lt;tP(L u'^_]UWy,?t.A0MV0Vݱ4 tQn%!L^-y u%=Lu!Ld} @!Ljj pH2_]U}tu(Lȉ L Lu3-LWj8WDHMjWDHM _3@] UV5LW}uQčM Lt=98tEPMOu׋E xuEPL$ DP蕒7u ~u3-MVM}rEPLN M3@_^U}tu(Lȉ L LtWLV0~t9 PLu PLv(Hf}t#u u,HFH9u LPL^] U}tu(Lȉ L Lu3-LEAXE A\E~A`E~Ad3@]U}tu(Lȉ L Lt$LjjEj 1AE AxH] U}tu(Leȉ L Lu3cELjKV0D{ 'K:F|؋EtEtu Nl蕐E3@^]U}tu(Lȉ L Lu3LSVW8jPEDHuظ#+CtVjuHt} tu juHu3A8t8#+F;tj8HtGH)GHjG3PPPPPuH3@_^[] UQ LVWtL03u(LEu3Z} LtMEPEPu ctۋMLML uƂ_^U W}9ufEPE 0|HEEEEEP7THEEEEEEEEEP7THEuEEEEP7@H_ U]qZUES]PEPS(LXMLUV0LW} EMut%ututu tuVt PU~8tL" Yt uݣFGFxF~_^]UVW}QAtBtP;u;NuVQ;P'N_^]UVW}QAtBtP;u;NuVQ'N_^]U]Uu(L^ȃu]%dH} Ltuuu uphHMPPuu]Uu(L Lft Pm3@ME Qu j uR]UEtMVujjjjVjuu VHuuVH=LtVLHLVH^]UeeVu 3ɉMSW39~ F^E M>UMM}v}UQuRu>$<umuE uuuuuuE 0su}uE KRQ0M3UuE uE 03u@ EEEEE GE ;~ v_[ju^UEtySVj3SjSuru S]SFPuHSF5HPujCPu uHCPu uր=L^[tuLHLuH]UVu(LLj0ME^ ȃ}QuthhudH]U8SWu(L` LD$ j06}tME  Quh=L]} jHHlHSWD$PЉT$\;LPL$ LD$L D$ jD$P5LjD$ Pt$ LЋD$T$ tu"Rt$Hjjht$pHT$RKd$$d$,YL$ D$,=D$hlLKL$4D$0D$$jjD$(PD$uCv$tA L 1VkFtjWh3pHVvj+udH_^[]U\SVWu(Lu D$D$HPVtHt$LD$t$LPLT$ L؋ D$8LL$PQL$DQh3PD$ |$$pHWWjV|HD$DHD$VD$dpHSt$|LjY;5Lt ;GtA;~;jOpTGP) 3f3@Hjfvj fi3SSh 7pHjHfyNFVw*75pH3Sj h 7օD$XD$TPSh>7D$dօG4;G\  =k=`wD$PD$(PVLL$3ۋSfGfwLLL$9X(F5dLhL$PsLL$hYFxLwh07pH3SSS5LHjjS5LHupHE L$(L\$(\$0D$4Z0E 3FhTLKL$Dt$8D$,7jVD$0PD$LPL$@:w V7Hw$6SHL$(0Qjj7@H@lH5yEjVعD$PHD$P7TH7衸 L<<vq<D$5pHD$@D$D$DD$@P3Sh7փ$D$|PShK7DŽ$D$HeS$D$5pHD$(D$D$,D$(P3Sh7օ)D$XD$TPSh>7D$d D$pD$0FSj S7t$4j S7jV(L3ۋΈ\$葸D$PHD$P7TH7Zt$u'7hHP(L7D$dpHD$0Ft6D$PD$(P$(Ltt$L9X ut$ D$P7HLH D$~B߃w1fAf#ºf;uA;Et `I A1f3_^[ËUQQSVu3ۋUMsAW3;Et+VHGRA9 t4UMPu u؍4r_^[UQQS]VW3w,UE9G0~XPFPu u f9D^txG44FE@;G0E|G0+EO4PNVP`X fE fPuFPF 3fD^G0_^[UQQSVuW} 3ۉUMt]HPSu uHB@N9tFEu %UMHP@Pu u躀u؋r_^[UVrWJEI]$m G J< t <t<t33A3;M 1 JE3;aK3;U  J39EJ J3ҋaKB;tǃt3뾺;w=ts r" vi tdt\tTtL J3ɃjXz~o+J;s|s7E=wC<]]] wC< 9M%~![|J;sfff;+u_^[UQE SVWډMxS;E}NE t+4uPܽKYuj+M 6 PE HQWM 3fw9jX_^[Vfu8tBf;tf;^E3^+Vfuf9t2f;tf;^E3^UEVWt+4:HRf;u u3_^]؍EUSVWj_+}t?ff#ùf;u+#=uF## ȁ;u t= t3MM 3B& t%v3B vt ;wыE 3;uvf~ tzE 8B_^[]UQQSV3BW#ډEs&t"T0t 30E3BjY"t fEjXf;u@}t,%=u% jX;tf;}t^%j=u## XX%=u#% jX;1;$ǙE}J3f;MEIƒ T$G J< << JN+ aKA; J3f9FJ JaKZjY;;w=h r~ Z QE9F rD ' v0)  / _ 0 J3Ƀ SƞYhc3G RKFPJ3jZG QYJjj6hHP@Hw],YG_ V袶G S@Af8[GHP*Af8]GD$D$PD$PD$0PD$$PV+KL$k~+KL$UNX,KL$?h,KL$)tGO4GmO4B+KL$tOl+KL$t)OOxlOxD$(PMdwOH+KL$tt$(O{Y!L+KL$ott$(OMYP+KL$Att$(OYT+KL$tt$(OYX+KL$tt$(O Yo@,KL$tIL$(O@A,KL$tGu9GL$8D$(P.LIL$OuoD$jjj[ L$(T$\t$0H t$HP D$D$d IL$(uσV IL$(t: 9\$MԄt1E3?uFP>3ɺ Q uV"EԉEEu x}VPW 3f>EuESEPyP]BM蟞EpC>˄tTC >M CAP0>3ɉC Q K MQ3V3u CE PxE KPWHP^E CK 3fHE҃VL$$^4ffD$ 3VL$$fD$E4f9t#VL$$64f8;tD$ PD$DPoYYpD$@PHYt$D$@P9f|DB\YtD$@hTIP:YYD$@PL$4OD$0P6L$0X3VL$$fD$D3f9JF?vWY CGl EtV1Y!Gj4Mt F;w rtG,3C3C_ٝN,vSғSΜSIYLCj"Zf;t5j'Zf;t-j"Yf;tf;t OSP*SYVh5Kf9 u3fLCOCPRSkY鰞39w GM j4Jt F;w r醞G,3ۋC9juFP<uSuMuM趞E0EVu QP(YPEP讘M訛M蠛t- Vh`5KEVh5KE0u 3逜EMQM Q0M貓t Mb u YML T!LM;HM@M4jEPMCf}tM褨T!LF;prFET!L@H;u EMeuh 4Kuu 2Fuh4Kuu |$dEA06C$$Ej0L$X$$\$d\$h\$lu%D$4PD$Ph4KL$\mL$Pt!uL$ h4KuuhD$j8ZjT$|$8fD$4D$|I$$$VYt$7$Hͯt&ƆXDPSHrjD$Pje5LH2h LH5TLVGhl6KL$ VPL$ $Svřr鉕u LuG>衙Q`NytQ<~F 鄚UwBFG 9Vu 3;uwut*CACAM``sP`6[c su IF%&K]}+}MM +]E;;݋ҋ3K3YPLH6Z馛QO\鑛p36,xnQyRcYQRNDQ%9>m6LH6ͯp6躯YYD t>9~+!QR QQQ7Tw LǑ鼇WMK;;o΋ o霊n΋n`΋_+Bu3ۃuÅ^uÅKuӃuW(3C uC;u?n΋n;jnPQ5nYP,nP. 73WM]VM]Mv]Mn]M/nM%n;u"RQmYPMmPϭ ؍MyMqaEP^EP^֋Q!MЊXMP)3ۃuËH u3;K Ht-tHH2KmϋBm;%KwKKjV3Ʌ&ϋ؋;;ou~ t ~ #SVSK  V wu9F l 9W۫ 1qVbMulP,lPPDpp8M3y u%3Qcv; vDvH3ɋ0@u Q& jȃt3ɋ3H9x<t?jt!M QF4u34u G;x|_Fxx EFF FC>jTPdH63HH3LH3蛪ijt6EK3Dj t$P֩ A 1pqVj豩 A@j蕩t6'6jyq6jYt V3;6=# @A{jZ+HtsHt3flG3ɋS QY99tQ1I0YY3fjYt SS~Y[7GA QEAEAERlPUYYM~2G>lth8Kh8KPYYG6lh8KPs'Gj lPv6WFTPLH6q>4QfT)pJ6CQJQJQ t/Ht%HD 99IEP.@38Ã^cEjP3,3EjjP}EA06t o3hWv  HEwWv (Hcu$HR jWPQR3ҋRRRRPQF/M3@6EjjPThjEPo6fF3NIEPE EPuQR E3E IV1W}WuRPQVE_^5AURjjjPQEKBȣLIV HrqQ;΅u^Ëq0QYy΅u^ËqQu΅u^P$HNtG8upef,f0pHp 薤Y0腤YC;r8t0HF;r t%hjplHtQxF;rI;j0jhLziI鰗髗ƃǃ鬗LLǃ霗L0}3tt90tG;r;tGˋP QPFjj@Pbc5H.=L.j pH?鎙D$P}CXLL$P0Vu:TLɕtQ<|$X!LD$TPL$0D$0D$8D$<D$PhLJ$D$@D$4zjjD$8P$P袃$wL$0D$dhdJ$D$@D$4zjjD$8P$PV$wL$0xD$hhJ$D$@D$4PzjjD$8P$P $LwƃFjj@PL$0ƃL$P锗=Lu=!Ld}!LjpHUj pHHtL$T菃D$PPLG|$XtD$TPtЍ$DŽ$DŽ$DŽ$[D$PhJ$DŽ$$-yjj$P$P$&vƃFjj@P$ƃL$PkL$Tu|j pLHD$t=@D$tPptHp HD$tD$P HǃtD$QD$PH"ƃHǃؕl迕uuG PhYvL$ d飕l芕D$D$PD$ PV؍SjD$$PD$$PV:@ PjruL$ H6v RRLHt$ QJL$ ۔r荞t$ 聞鿔Q@骔Q@镔Qz途ǃ達j pHt3|$;r\D$=+$&ZG4)4 jxHjy/jPHqwQD$PD$H~mtu]L$x0D$xDŽ$DŽ$jD$|PDŽ$Hˉ$MtL$xƃHǃ!%j pHht,l荃|;hrt3D$t$u(XD$PT$< |$t$ t̉D$DtFD$DPQtH|$DujtLHbt HD$Dǃtu*t$D$yjKQ\$D$PH.jPHsƃHǃpHQD$PPD$THؑ$PH$PHjjj$PօWGWGWGWG6kt @S@P"uEPM;ou@6=t@j@PtEPMnuLH3ƆƆMEEPIEEĉEȉEm]M3E){k8wЉUJQ/zE]P fxu5Yf{3t ;$tuwAGfxt΋]DGfxAu"G3ɍ@fGuAGfHu+Iy23M"gEU@G]E;B}:Eef@utG묋]΋CD@ Ph_p2EĉEr;ExE#E3ۋ@] f9Xu#$t u Gfxt]]C3ɍEX@fGuABfHuqIyxE]U9E~sGE:PEPEPuEEE[jSEPE@0yM-f@utBcEjS0E0yEUE@EBU;Ph0/KMp3}jjH#EPEPsyMmEj@j@P LEM{MߘMטƆ'MU2΍hTIPYY9\$fuT$,!F jHjmgj_3Aj_pL$4NzM A00F{dM 7Aj_oPD$Hh5KP荴 L$DJdM A3ۉD$MfA oD$D$DfM I oD$D$4fT$,jjHDlfEPM^fuqQ-΅u^E3eMճM0EM>RM tBPRFjMTrj)cqEqvQ8] rjfM]EuE8]uqE@x qj]_q;|=v u뮃q| =qj_qGH\nHtHjj^j3FjFjGV8kRPEPM P?xMjFJ]u EF qu V4jqMQQ%&K$u} YY]BE|jjRPEPXPwM|D$43PCA陬L$4 f¬u &F {t$ T$uD$PL$d@x6~u HFjHj$DaP+YP$QD4HD$@$f't#P$aD$L4H@D$AfuD$$PL$,Z$eHt4DVg|$LEj)@@ȉD$虵t L$(&lL$-L$Aff D4D0-g|$Ej)@@ȉD$?tL$(,D$0L$,L$A0L4H驴D$ PT$D$$YH@HtmH|$C 3dEj)HI跴tL$(Dkt$t$VIHY5 L|$C 3Ej)@pOj)>tL$(jȉL$L$3f LLL Lt L@ Lt L LtL LcL LOu 38L|$F &Ej)HIytL$(jt$t$Lu bD4Dˋ0D$f|$C 3Ej)HIt L$(iD$L$鍲mrtvvjHj)fwD4Dˋ0D$L$8D$ PT$C 3贲D$YL$8D$$PT$蝲|$ YEj)HIeu'L$;L$ | ;L$$T$zL$(jaL$(hT$D4Dˋ0D$NL$8D$ PT$C 3|$ YEj)HIu&L$;L$ | T$ gL$(cjL$(JhT$BD$@3PCI<թL$@`u &3@jF PHdY|$ujHjdu q&WjZT$ jXD$D$ D$ D$D$tH9PuCtT05LHtQ謁 钪D$FD$;r鲩D$0Pk`8C;r鉩@Yt ټ3ɋ镩tQ3SHPHu F ͩjKPjpH|u F jHjbYv迿F jHjb:{dYt u蚦FGFx{F1PvWv薈3)HthHtJrSD$PD$PW7tl~q^uD$@ Pho|~D$D$PD$PWv-D$PD$PD$PWQD$PD$PWQqYrOD$fx'r@ Pjr^rUAPRuMVWQ:RQGjNDZf9PQwQG@ Pj~ G@ Pj}M\^QuQWz+Gp8}ut$jp&^ED@ Pjo^UUA@ Pjo]DM@ Pjo]OQPS w詆BM@ Pjo]MFeeejEPEPMV1xNEf9xt@ Pjr<]M{VMQcy3MۼUnU;UGVjh\4Vt[Jt huu VSe8Ut!@ttu RVSPjA Pjn\uu VS^HFE؋FE܋EԋF EEEPEP Ll95 L`EPEP L1lu5 Lpc}CM@ Ph[j>e$UVMkDS \u j6u|M8uuEfjMO}tEP0dMhI7u'}.OV2Fu S}[EP6j!|9u~(} SR[j7V{F;u|ދ}O39u~O9F;u|jWzN2U t3ɉMU;SCE8wf3uU MUЋEfNt3fGt-fOt$fHtf@ut*fuu}U IAMBUЉE;Sru}U U LSCM@ PjyYCM@ PhYCM@ PjqsYMWh`Yuj}MNYuЋMh9YG MPh"YxuЋjnYgQMhXTM@ PjX=CM@ PhXCM@ PjXeejEPWQΉ]aLHxME@jYf9Ht @ Pjr)M|^Lt=wjh*XM\tA Ph X鶼Gʋ@@ PhW鏼jjatMjEPE PW~g*j@at#MjjEPE PW1;]]GM fxNt¹8jEPAE PM MW0]uMEPg鏺jM`M؄tr%LjM6LjJjMJjEjP! jEjP M PgEPMg j9`U3H#‹@x~z3ɃjI#_j)t?zK6K0vt'M3}H#EP#(EPMf醹MS{fEPMoflMhIhWMǵMEE豵EE.]jhAKjh#GyOE @ PhUCM[EEظuK 8kME jEPE PW)EPMeRO˄t \EW;jM^]jM^KMOMt [2W(@ MPjrTdE@YExM\MEEF}EPEPSEE CM%=˄uAhIUMMEEE@EE鶸EP[dEPMOdE`PE@釸MQdTMƁi`UClMoEEME`PE@$@ MPhpSue|V\|M^g9kEDCkjjU,k:#kjQCMUEj${GjRLHu{jjQ'|jMcojr{u{TjLjQ?j7jQ*j"jQ蔰jCFjs3ɉE QzEt MtQPV$t uzu2kf0ZkjgzЃt! HJHJ@ B Ak3҉8kGF)k3zs zk} k} kMBEPEPVElVMfxuJ8uEDfxu]kU~kUHF@ PjrP/lUHF@ PhPlMjjvPkdEPQƃik@ MPhxPghyG@@oyG@yGyGyGyGyGyGBX06eURC PW>r{,hEPb`KE AfKjCK pV;2K VK p薯s sC,DK UPDjjV؞ jjVÞ P_KE AeCK @pUN;K |UK p C,s {us3K RUPj)襞t=N6Knt%{uCP e3P eV_re脮G Mq`dF t qeQWc~ Ve7M 9WvE1qVsp K 7PQ<7PEPNpE pwMps 8rc~ EuTMȉTcQMȉCcEG O/cdVWG  cQӫUGcQ辫UEb b$nGM؅bQLHuGvUbM؅bQ8"UbM{]UbEpvuuUbM؅{bQFUmbM؅bbQWUTbM؅IbQU;bH؃jb$GMuK K(jVvSU5bRM؋}R;sUbsOM؉EfO;O 9EDUa(5M؋5;#Ua $GaF؋΋XOtJjUCmR莟E]H $GEM؋ Ot,JjUcCmEU!aE؋UEaR(EU`m؋UE`E؋U@E`}Ut E`E`UE`E؋UE`.`@`>t``wKKjVQ`AaMKEM;`a;E`aKy3ϋp3;`` $ GCKMtJjU BuU`RȓU_s_CZU_38C_Cp_KIURuU_3_ $2GGϋMtJjU\AEUd_RUS_赕UD_388_@._IUREU _3_Jq0t QCFUrB _STaKE A^QE^ ^$ZGM؅^QLHu{q^M؅^Qo^MX}^EpEqu:q_^M؅T^QI^M؅>^Q3^M؅(^Q0^;G@@~G@"GKGlGGGGGG-@G-@-@HG-@GxG|GGGG@GGGG!G]GЀG]G]GG]G@G/GfGnG'GGGfGGGGGe@G؂G^G^Ge@^G#G/G9GG@@ɃG@GG,GXGXGBGE E@@ PhFVMpV@ PjrF@ PjrFGu RQ3iu QR%i`8HE  iu RZhu EPRNhjEPR OhjEPRtHhjEPR hjEPRhjEPRShzv,Gf9pu#8 uD0HE AfhjjiEXhEPR\IhlD9hjhcE(hujEPEPSEEEwKEfxt@ PjrEMҤn Lpj!L!LPhG莇jjk!L!LTPhG]= Lm0nq]MC@ PhzD^mEEE1dE]EPEPWf j MMujMMWtDj MMtEfE3jMfE3M EȋEMQxHE MMPPjM0MtBuxNj4 u-3xMԋ4PPP3P=BjEPEPtPutdOMldOMآUjE̍MċFtJjU:E}Ћ]ămR蜌}Ћ]ăm]ċCm]ċ|mKEPE]mE̍MċFt!Jj|m:|UWmR&UDm36m KdPdUmUrc7)mQBEm m$ GEąnmPLHujWmMąLmQAmMR4mEpjujmMą mQ mMąlQ lMąlQ胟ljJjjEPEPWˉujiuEl"@Uhf5t fGh}EPEPWyXiuU{hAD@ Pj{ujzM@MTviGM@ Pj|v@Zijh@Kjh1=i]MCM@ Ph6@ifSLhfTBhfU8hfV.h@ MPh?hE܍MԋrCt$Jjd7du]ԃkR|u]ԃk]ԋCk]ԋkK|Pd|kE܍MԋBtJjUJ7]UkRUk3kKEP]̋UpkUoAD@ Pj{ujzM>MRg4ckQEk k$6GEԅkPLHugkMԅkQ~kMNskEpTguIgUkMԅJkQ ?kMԅ4kQ )kMԅkQ?k@ MPjr=f@ Pjy=fEPfEPxfEPhfEPrXf6fPLH6~f ffQs fpWf6MfeeQeeQeeQFeEePLHueeMeQeEpeueeM~eQseMheQ]eMReQ讚GeufeV]eJeG@@vG@GGيGGGGGr@r@Gr@܍GGGIGIG3Gt$4h;,t$4jo;۪L$$̢Bfx3tz;|$LH$u\$.D$<BFfxt] D$KjL$L$(jDDt/CL$fxNujjD$0PD$ PS#dL$`DD$(D$`D$`PL$TD$p0铧D$ϋ@D@ PhA:GD$@KD$0mKD$@ Pu jy: h9C@ Pjo9D$ PD$TP ;u)L$tL$ ~D$D$PL$x1NuL$T$\$,鷠D$Hߠ$t u Cfxt\$$x u3ҋjVR0 \$YVRS LD\$CD$:t$0ICI\$ HCFCFC F 鬤P\Ft PaF3ɺ Q%a3ɉf xTL$$\$AD$DD$@D$(PD$dPD$LPS)jLJNL$$jVD$hPC0BWD$L$$@@ Pjy8 K$P4C KI;>r|$LlAX8陠{ sNB韠N衞@$駠N芞 P$G顠NY8tQ詞^F 閠FH8 }D$@ut$4jp47:E/jjj`L7u9E p9Es9Es9Ev9Ey9E 3wAjYf9HEHN}Eu^MWMEx;CWhSEM AjYf9H+EHN}Eu^MM:Ex;Wh}tMUN;ME}tMN;WhAjYf9HEMpAjYf9HuEHN}Eu^MQME܅x;=WjhSE܍M CD@ Ph5Wh-Wh%WhWhWh C@@ Pjr`L'5cGPp^YwG EVF uN5F >5("LOev v$6GvPLH7]yvovQ dvDXvps]7i]u biL$ 0:: |ehJ$"LD4 !L0R$"LD1L$`Rpt$0L$VuNL$pt\ 1sL$xqQPVDT t$t[pQCFq q$GqPLH6ZqqQq B{qpZ6Z_qUqQJq@qQ5q+qQ荏 qFp8kqQwT$F(`q `q$GF NqPLHv YT$3qN (qQT$qN 1AT$qF pYv YT$pN pQT$pN pQ T$pN pQ蜎T$ph "LL$$D$7u }WDfxGtr$A$A$A L$$$P9 $PL$$7$.^f$PL$$7PVW|$$j;  #fD$2r|$$D$, $PL$$DŽ$DŽ$DŽ$7u L$PVuz $PL$$6L?$貎a|$$ $PL$$DŽ$DŽ$DŽ$6u L$PVu_zJ $PL$$h6>$3FaAM aAM aL$TttD$ PD$XP~y^w|$$ L$ 5L$ t^n'] Ep@fWuAfXuIftf@utBuЋ\$XD$\$4>d'u \$XD$\$4d|$$E = QD$؋@fGuAfHuIftf@utBuϋӋ\$4Du fxHE(r rB_AM !`h8KD$,.jj)hID$,n.jj*$h "LL$$3$PL$$h4wu $E+ cDŽ$DŽ$DŽ$D$t/D@fHtfOuL$ 4P$cGu`PLH6Q_`U`QJ`9>`pQ6Q"``Q ``Q__Q蝆_5("LOH\6CQv 8Qk \$jG[PLH7Q[[Q[A8[pP7P[[Q[[Q*w[m[Qb[5("LHh h$GD$hPLHD$0;PhD$hQ,hL$q7~hD$pOD$0OZhD$LhQ9AhD$3hQJ(hD$hQ݄h LpD$0Z !L!L2hGiD$4Z[_[[ !L!L1hGh5 LD$4]`^ ^sSOދt$\$4\$XD$]b|$-Xj@PjƄ$$L$$-p5j|$-t D$pwjt$njsSNރ\$4\$XojsSoNރ\$4\$XD$]_jE@L$@ Pjo=%$L$pXOD$X$$9L$p7OD$xXE@D@ PjoL$$L$pOD$IXGL$@ Ph$$#|$(|$D$XGD@ PhL$u$|$(|$D$W$D$W$D$WE E@L$@ Pjn$D$WE E@@ PL$jn#|$(\$X|$D$\$4JWE E@L$@ Ph#$dD$WGL$@ Pjn|#$4$(D$VE E@L$@ Pjy:#D$Vt$dL$jk#Vt$dL$jl#uVt$dL$jm"^Vt$dL$jn"$菂D$?V]PLH3K] ]Q]2]pyK3oK] ]Q] ]Q] u]Qhj]՗G9A9AG9AGGG'G'GGGAAGAGGܘGGGGG1 A1 AuG1 AGGҚGGGGG A AEG AkGGGGGқGҡGAAGAGޡGG$G$GGâGcAcAGcAGѢGG'G'GGGAAeGAGG£GGGףGvG?A?AAG?AaGGGȤGȤGGDG A AG A+GRGvGGGGhAKMJ"uMĉ}0WEPEPEPV*9}u uM 0M#N@>xLu >3-N@M PZ07-P@HPh4BK@?Ph5KPj PhhhCKCK% HXCKP,h@BKEP?>M PkM-hhBKP\~?>M P?W,hHBKtPDG?t>M PthPBKdP?E>M Pٽdh5KLP>>M P誽LfhXBK4P,>=M Px44h`BKP>=M PFjUYM2E=+EPPEH_hPH+@!Lhx0PMԉ}ԉ}=9} uHu N}*u 9}*u $} *u }*u | *u |~*u |i*u |T*u |?*|^ )3C8L 3C8Lu tl|^ >)u X|@)u C|A)u .|B)u |C)uPMxPh H!L@2t+tM t h H3&hPhd$KhPhDKHPh4H^EPPEHi0Lt H&u x3ChPhPDK{hPh$KehPh$KOhPh$K9hPh$K#hPhhDK HEEyjKu ]E]wEF P%j!uE̋@ Pj|\dG MċUeZdyeJjUE]d]Cd]dKEPxEȃldyeJjUh]|d3ndfKEP&]ЃLd tdQcuEd d$GEdPLHu?dMdQdM)'dEp?u?jdM_dQTdMIdQ>dM3dQt(dEʋ@D@ Pj{MGMS*bjjEPu u?}c cwN莸BbQ/tFc b$,Gp>6>aaQaaQsa˄tVWu uu=ajh@Kjhy'E E@@ Ph8aju u5haj u4ju'uE̋@ PhCatVWu u<auM3fE3fEڋE j  MЄt[j*MEЍEPE Vu EPjߍx uqM M`j4EPePM3MMEPE E PVu EPjyxtMn M肖` _wND_QqF_ _$XGp<6w<__PLH6W<_#v_l_Qa_W_QL_B_QDq7_jU_VME]t+EP5ME0c cp96 9ccQYccQnccQncKqtQm sC bG t h)Vc E uM +ȉcM +ȉuc>Eϋ+șMȋǙ+MEU;u;u u 9cu F ~%c+WVF  cQ$mFcE F N;`w7RPLVF `G t  gv6RPV_GϋtJjUQm_R*b_?i_QjlF_ b G$G{ Ct@pc hW誆cVEPP[M cCP>e{ Ct@pNe}PNE g gCx1_{ Ct@p(_ωE |;cR_;E cD_=ϋ4;Gً؋t#JjUmU^R`U^@U^?LhU^H w$GFً΋t(JjUjmEs^h^R3`EU^.J^@<^>t .^'^{ Ct@p7a{ Ct@p^ #^$@Gp464^]PLH64]p464]]]Q]]Q]]Q}iy]Kq]aQs^Cx]FωE :;!`^9E `]ϋ;J $lGA؋Ct-JjUmU|]Ur]R^^UY])UO]@UB]9t U3]U)]Gًϋ tJjUmE]R]E\/\@\?e\{ C@p^ [$G[Qg[[Q[CpaECPMTE%PMS̍EPASEPMhPXMhMhMhX[R[EPEEEMvh[E u xIZ2G A AG AG>GZGGGoG,#A!AGG;G4u7CtjPPPP1HmD$FD$;~TD$(Pt$t$85pHhSw4D$8;D$jPhw485Htw8փ<twj3L8F;|U$u0;;uu L;L 73j@Y3O R(LEx L@ EPu$|HEPu$Hj8HM+Mj+M 8HM+MU+ѹ#U ;u j8HE E ]}W}Mjju(Lkȉ LLu(^ LjjjjWjxHEuM诖j؍EPjSWH]jP3PPjWPxHEujPEPsPWHEMpH=$Ht$QjhuӃ~ tv ׋EF MEt$PjhuӃ~$tv$׋EF$MEu#E]jju@HuDFlu(L/ȉ LMu ȉ L?8`V:3ɈE6vEDaGw @NE9]ub^]j]f;ىu[r>f9Uw8= uk EUЍFEEf;j9UZsƒ|y;E ~tu>8ϤUj7+X^]Bj]f;[f9Euj7Ѝ}uQ9]'_Kt f;vE"鴡(=EI鍡EOFEAf;l_K_uEar EA7+}|.E~Ff;_KFf;_KFf;۠_KΠFf;_KjZar A7+Ju݋M%;vELgf~{tEQKj0Yf;r}AEPf;f;s E%鷟Ef9FNV E%镟K鎟f;EKf;EAf;ED2_}k(:G$GG; u}G;t u8W3?Pw YYB6F UGu+Ѓ#Y F 먁F ˁUF {F 랁(F N;w/   W / _ 0;w/   e / _ 0  $;' ) y  g;ZFotHUE;nGj^;t2t-A;wBkkNKZ;t ?3;E3;3;ÉEt t3B3ҋOEk QKA;zG$VGG 3;E;My}3;jO EM̋G kOK;EϋU݅MK9Et5MKU9Et(MK9E MK;ЋUuu3@U3;lU/MK9G LMK9G ;MK9G u&3@ MKUkOKtMKkOKqTUtHMKW kOKt*MKkOKtMK;uu3@3;t 3҅Y]} pEȋӋttHtH*3GEH3GEH@EH#;r39GEG GoGZGGGGG'GGGOAGGA    oGGG G3G@GGGG}7E؃\ufEuE鿅xM(t },u+yf+xfx}Džx@Xv+y3fzfJ}xU/M(E܁wA 0t}7vE܃#}ft=q|t;I;PE(PQ֋rM( tD9M,uE(+xxf+xfx}x9MvBxU(+z3fPPf8}EU]Et#}uEf}U鐃f}Uz]Ef}UOE(@`E @E83ׁGMKEUUGpNKEUKۄM 3f:HE83wM(A`݄U%pfEЃUuEЋM}|Ey%=߄G % ؁}麄+1Euu鯄\„fEM؃E3w:t.t =U8z3EE(X:~&}f?^uuu}uU+ȅ/&Ut 3H# tz]t{}E/E E83zE}}ԉE؋EEEЃuEЋu܋MEE|t\tZÙJ%yHȀ@MI JtUB fB}US{EUfBtv}BU{f}U{}TfUuyt I~U}3fpf3ufB~>fB+ƒPRB PU^ (j PuqV U։uM+fA}Oz (A r}yu EVPOU>}!UuE?,Eb](f;wK tGf;vf?#WftE܋s|Kt(;sQPPQ֋ t5 3ۃ'K㪃}p ߉}HrGHr"rEj}Ap/j![j?$H$$H}ftf)t#}fuE E83hf?E}UM,pf?ωuMu6fCu/W0rf9w TG@0sf}0r 9f;M(I }}Ef;Ewt}Ef;Ev+EEE,tM~f}f;2Mf}}f)},yEȅ -M(A@+E@E'uEE-t+t093ɉMȃM}E0MMf9= I} HMȃ0sA@EM(: ;AD1 M,fB}%nE(H,MԋM(3E9A0~=]ԋuMSt G4FC;w0|ߋ}UuuE]ԋ]M(;A0M}EM(}GE;y0}jA4uԋ]EuMVSu E(GC;x0E|܋uU]]~$EfBM,fBEfB}E?mEȋM,fB}-m} Ef8Rum3Ƀ}MEA~8MAMȃ09 I HE@MȉE;E|̅uMȸfJM,fB}l}jLK,sUM,fB}EllA\UM,}}Sl}f?)u'G*t+t?t{u"OetM(A\UM,~ lUf}UEeGȃ!tX=t7Ef;E E(@  M(<+'&M(UA\M,}kM(UA\M,}nkUM,}XkUvf}}3ɉxDžX0r f9w I} H0sf?)W 6 fJEM(+A@fB3fB}UEc}=t,>t}}0r 99 Ef;Ew"I t}Ef;EvM,+EEE(@@@Ef9 U(J0M' E;B4~ } B4N B(3҉EUԅU;PUuOuMEu5M9HtPE M(UAxMB UԉE;|)UԋM9HMuE AE83+aMU;U(B8;|YE@PܽKE(H8 IQp(W,U( z8~r( KU(Ez(B8B0} @B(c ȉl\cx"]MDždExdEEed}[][LMEq[E E83 ZE E83YE E83YE E83YGygES83YE SE83YE83YE }E83nYE E83WYE E83BYE KE83-YE ;E83YE BE83YE TE83XE #E83XE E83XE E83XE E83XE &E83XE 'E83jXE 0E83UXE +E83@XE }E83(XE 1E83XE *E83WE >E83WE :E83WE }E83WE }(E83WE E83WE  E83wWE }6E83_WE }E83GWE E832WE RE83WE 4؋E83WIGGGGgGCG^G>GGGGGG   I HS H H H HBHBHBHBH3H3H HkHHHHHHoHHHHHHH|@     HHHHHHH"Hf3t$Dft$L$ OT$@33 WfCQ#ӋYYȃu_tePx;OH~OHD$DfMPuj$X3H-M MD$ 3P+PQAP9L$XfF+L$h fjxYfNL$ fFPE F4Ff9t> U FJAJt;;J s%E +P;dE ;H r3f9CcMvu=| =Au W@YYAjwYF4Ff9tN3G_@f~ cA_PZA} PApAAu W{@YY,AMjwA AXMf9g@3@ AjJ^f|w*YE=B3f9HuLxtxfLxS0Q j5YYȋEftxx.;x~xufHjHYEuu:u-j$jF^S KYE+EMM Ctj^}AEȃCAK A9utbf;r9Jƙ} MI J;ƾ4f;AK Af;AJƙ} MI J;A C A3PCREH YXY}Mujjjjj3|p;r+ȅ~ً,rEEEEEEǃpC(C(;C,f`IGȍtHl:llGfgwEt WUE;CgK U3E؋+CtEEEDEȋC+EE̋EԋU+SxK+MC r ǃEM@PuS`Iu Gu"fȃu:ME ECtfs6 9E*eM+ff;C4effAf;C6eeCxH9Ed}bEE}bK|E;StyuCPQM0O eEd;C|d{ud{kdEff;C4[dChGdcS+ȋE;wff;C4ueEf@f;C6pe9SLc9d;dCh}a9SLc9S\tE;C|c9뱋K|E;sSstuVQ N u:+ȋE;ff;C4tEf@f;C6C|+9EE/E9U;CxPff#f;u;s %=uB% ȁ{Xt\_uEqoJyIɀAEI JaKtu%E sCDt EE3;C|sc%=uE@% ȁ{Xtv_J88t;vChe3f}fW;{_as֋CD+;Cx;w EH9SXtY_uqqJyIɀAEI JaKtu'E"f;wCDt EE3;C|{XtY_tqJyIɀAEI JaKt1Hf;ȋCD;$^3`SK|t%Eu;sSVCPQMJ `5S+ȋE;w#ff;C4u_Ef@f;C6_uEt7;C|Er,{u&{u ff;C4uChHEK|;eEu`;m`ff#f;T`EK`E;C|]eE4`E;C|FeE9Ut.%=u E % ȁE_CD^_E;C|dE9Ut.%=u E % ȁEx^CDk^h_E;C|zdE9Ut.%=u E % ȁE_CD^_E;C|dE9Ut.%=u E % ȁE]CD]^E;C|cE9Ut.%=u E % ȁEH^CD9]6^E;C|HcE9Ut.%=u E % ȁE\CD\]S|E;b}Et1%=Eu % ȁEE wgt r]j\ a\b;r2P];D]Ch+]f8 !]E]t[{l[\E;C|bE9Ut.%=u E % ȁEw<[w[ [ x[u\g[d\_ w/T[ J\ <[/ 0[-\0[\E;C|.aE9Ut.%=u E % ȁEw<[w[ [ Z[Z[_ w/[ tZ j[/ \ZY[0KZH[E;C|Z`E9Ut.%=u E % ȁEwY Z YZ( Z) YZE;C|_E9Ut.%=u E % ȁEwhZAZYWZFYCZE % ȁEM+\ N$H J< t<t<t3*Xk\ J3ɃRtSUQMSVȃ  KEHEiR3҃i3mOMEGE؅uE}SE % ȁEMSnTUE*UM;C|)Z]]Ev nS)Mm]MȄ ]SEME9M~TE@% ȁMETnUZT;TChT;U}l;C|sBMvnu!Rm]MȄ ]Et3BE;U|%t;vCh|}P;ERuE@PuSu u!PQ;usQGEG G™‹UJ%yHȀ@MIMԋ Jw C@;H;E HOE;G uwC@ ;G}EGEE܃W3E܉UBtOt 3҉UȃUȃ3MЉEEMЉEEk3MЉE܉MV_3MЉE܉]=HH+|I IUȉE܉MuEM}]]}t9E%=u']% Ë]E}̋E܃HutN}vHE虃‹UJ%yHȀ@MIMЋ J‹UȉEE*}]wuC@0uEE ]]]Et~E;C|%L0E%=Euu$% E؋EE]9]Eu;E]C;]܉]]~AE|9;C|K09unE9]bE]C;]܉]]E~ʋEu9u܋u'C@ЉU؅u;u}nE;C|UE%=u%Bee % EEE9Et9EtEFBU;u|EU؅B;BMu؋E@PuSu uBCMff#ºMf;uM;uBt;vChoU;U}Pu;C|s#;]t>09uut3BE;U|%t;vChAu;BME@PuSu u*ABMM;uAEt{]E;C|I0E%=Euu&% EEEu9uu C]C;]܉]]~5|-u;s|(<u9EBE@E;E~ًuE]9]܋]@?ЉUu;u}iE;C|UE%=u%Bee % EEE9EtEFBU;u|EU@;~@MuE@PuSu u?MAMff#ºMf;uM;u*@t;vChaoU;U}u;C|s`;t EEB;U|E`?u;?ME@PuSu u>@MM;u?t;vCh~[@GȺE܉MUȃEGU3҃\ƒE3ɉUE3ɾuЉMEΉuЉME3ɉuЉMu܃zEG3ɾuЉME܃^EEEwu}ZE' 5$H}(@EME3E;K|7]Mte}uM]C;]]]~DMED;K|7}UMt0%=u" % ЁUM™‹UJyJʀBEI J tt t3;E?E@E;EMUDE DM;K|6}UMt0%=u" % ЁUMM™JyIɀAU3EI J9aK;MT>E@E;ESUWCEGCM;K|6}UMt0%=u" % ЁUMM™JyIɀA3EI J;E;M=E@E;EZUBEBM;K|E5}UMt0%=u" % ЁUMM™JyIɀA3EIJ;E;MEME>;K|j1]Mt2%=u$ee % EEM]J]9]]]rME9MMt2]9]]]s}9E@;EEE_ >}8܋EME=;K|0]Mt5%=u$ee % EEME}$t.}@t(}`t"}r }v}ErEu9u38]C;]]]X<=}ME=C|E;/}UMt0%=u" % ЁUM™‹UJyJʀBEI JC|U;]EUt2%=u$A% ЁUEM™JyIɀAEI J,ItEM AEM;]ME]t ;r;vChFE@E;EU;EE؃+E؃$~HEMEY;QUS|; .{EPCPRS 6MUt.;S|r){u#{uff;C4uCh}MU;K|s'fEf#EEf;Eu MUE@E;EJU:C+;gff;C4Z{N5Uff;C6>5>EMED:E;K|,M;K|s$fEf#EEf;EEuME9E~9C|+MM;4MM9EME9;K|,E%M=u#ee % EME w(t t@F4(;K|s-f9 u'M=t4{l4E@E;E]9EME9;K|+E%M=u#ee % EME=w43=w3 }3 t3D=g37=_ w%X3= r#= F3=/ ;3 =0.3E@E;E778EME$8;K|*E%M=u#ee % EME=w(tY=wtP tK 2@=23=_ w!t*= y2= v=/ g2 =0Z2E@E;EGc7EMEP7;K| *E%M=u#ee % EME=w1 r 1=( r =) 1E@E;Ez6EME6;K|h)E%M=u#ee % EME=wt21"1E@E;E~/6EME6;K|(E%M=u)]% Ë]EME=sMCDM0E@E;E~5EME5;K|G(f9Y0CD]F0E@ME;E~M5EME:5E;K|'f9]sCD]/EM;K|s$fEf#EEf;EEuME9E~4EME4;K|u'f9/CD]t/E@ME;E~{4EMEh4E;K|'f9]sCD]/EM;K|s$fEf#EEf;EEuME9E~3EME3;K|&f9.CD].E@ME;E~3]؃$]؃$H]MEz3S|;1&{tCjPRS ..M,C+;w!ff;C4u{ .fAf;C6-t1A;C|r){u#{uff;C4uCh|E@ME;ETU2]ɋC|+MM;p%MM2]ɋC|+MM;M%MM}2]MEj2E;K| %] ]M0} t} tKE--;K|s5f9 u/M'}tE,E{l,E9E~1]EME1;K|$EM=;=,=x, o, f,P}W,A}_ +F,} |)} 0,}/ #, }0,E@;EEEU1]EME1;K|#E=EM5}ti}t^} tX} +L}+=}_ 't2} w+} ~}/ a+ }0R+]C;]]]\[0]EMEB0;K|"E=EM}*} |"} *}( | }) *]C;]]]~/]ME/E;K|z"]]M}t%Eh*EU*EE9E~c/]MEP/E;K|"Ef;]]]wEȋCD)MEEM9E~.]ME.;K|!f;)ȋCD)EM@ME;E~.]ME.E;K|I!Ef;]]]wEȋCD=)MEEM9E~B.]ME/.;K| f;(ȋCD(EM@ME;E~-]ME-E;K| Ef;]]]wEȋCD(MEEM9E~-]MEr-;K|+ f;7(ȋCD((EM@ME;E~,-Mȅ $HU;UC|EԋE]E;MsMt%fEf#EEf;EEuE}uJ]B Y]M;U|3&;Ch&U9UE;K|sUt2%=u$A% ЁUE™‹UJyJʀBEI J tt t3;EPEԍ AE@;E܉EEMD/U9U#E;K|Ut2%=u$A% ЁUEM™JyIɀAU3EI J9aK;MċMEԍ AE@;E܉EEMFdU9UXE;K|Ut2%=u$A% ЁUEM™JyIɀA3EI J;E;MċMEԍ AE@;E܉EEMMU9UE;K|QUt2%=u$A% ЁUEM™JyIɀA3EIJ;E;MċMEԍ AE@;E܉EEMMU9UE;K|Ut2%=u$A% ЁUE™‹UJyJʀBEI JaKt t3;E*Eԍ AE@;E܉EEM> U;UuE;K|]]t8E%=u&Aee % EEEE}wK}w!} rl} } u\}}uA}/ w!E)w 2H$*H}_ td}0t[MJyIɀA3EI J t0{l t! tt( t ) S|M@;E|E;E;K|)4|n e uM[u@N_ '@ |% ,/ u0@M;EmE;E;K|(t]tS tN tIt<_ #t-  ~/ t0@M;E|nE;Eb;K|H | 9( | ) %@M;E|U;U;K|=tvBM;U|U;U;K|NEf;EwȋCDMBM;U|U;Us;K|Ef;EVȋCDMDBM;U|3U;U';K|Ef;EwȋCDMBM;U|U;U;K|rEf;EȋCDMBM;U|U;U;K|&Ef;EwȋCDMulBM;U|^U;U}V;K|s,Ef;EwAȋCDMt3BM;U|%t;vCh+V u; E@PuSu u  M}Mu;vf9 u fy uM;ul E@f?zPuSRQMuW ; }: Ud   ֋uE =uM9  Mกf9U ff#ºf;uM%U=uA% ЁU™‹UJyJʀBEI JE;MK QUu Fff#f;uU %=uB% ȁJyIɀAMEI J,ItMMUMM,ǃOO9pf?wAf8w\2E@Pu`IGSu uOMc  G EE; P K M; Q KE E@PuSu u  E@PuWSu u_ EL u- EM@PuSRuWN  EE E ;{ Chg us|> ;s|5 ;묉E;|iEu؋MSV_u xM AE@ME;E|0u(tC|;vChM;M EM@PuSu u.U؍BU;Us3uC|Ed ;C|[ ;ƃ;EB ff#f;uE@PuSu utYE@PuɋMSu uq-U;UM;K|E%M=u)]% Ë]EME=v nn%m]ȃMȄ ]JME@PuBSu UuHp;HU;UE;C|MEv n m]MȄ ]EM@PuBSu Uu tE@PuSu uE9EF;s|sMUt+%=u% EUQuEE@PuSu u^u;);S|;9};Mb;K|YEu@PuSu uU ME9EC|+;wPuVU uu:M܅C| +‰U; PEPVU uuEE@PuSu u.MUlEu@PuSu uE;EZ;s|9Mt 9M@@E؋E@PuSu uthE@PuSu uEM;M;s|9EE@PuASu Mu׋>tE@PuuSu uM;Ml;s|%=u % Ё9U*9U!E@PuASu Mu׋tL<E;E;s|9M9M@E܋E@PuSu u,tE@PuuSu uM;MZ;s|%=u % Ё9UE@PuASu Mu׋tCw3M;M;s| 9EE@PuASu Mu׋,t .$޺HEu@PuSu VE;EVM;K|-}MtuM}@EE@PuSu VtLEu@PuSu Vn*E9EM;K|}UMt0%=u" % ЁUM™‹UJyJʀBEI J tt t3;E%EE@PuSu V,QE@PuSu ut0uE9E;s|}t*%=u % ȁJyIɀAU3EI J9aK;MCEE@PuSu uCkE@PuSu uJuE9E;s|}t*%=u % ȁJyIɀA3EI J;E;MdEE@PuSu uJE@PuSu ukuE9E ;s|>}t*%=u % ȁJyIɀA3EIJ;E;MEE@PuSu uJEu@PuSu VE9E,M;K|}UMt0%=u" % ЁUM™‹UJyJʀBEI JaKt t3;EEE@PuSu V*E@PuSu uuE;E-;s|b}t-%=u % ȁEwEw r_  uQu8/ wt{)wH$ H_ tZ0tRJyIɀA3EI JH w4t B2;s|f> t{lw<w} t kZZI_ w/G / // #0w<w  _ w/  / 0uws ^ aP( D) D3w%B%CDCDCDCD|CD{jjCD]L;s|C{9{/C4;#Chԏ @PuSu uMuM;MS|;E؃ uV{t!jCPRSK M,C+;w!ff;C4u{fFf;C6E$~H;s|{{C4;Ch؎ w4t tB2;s|]f> SKt{l%w<w  |_ w/i  Q/ E04w<w} t fU_ w/G  // 0 w  ( ) fwBG3CD}CDbwZCDKCD0w(CDCDE@PuASu Mu׋xǃOO9f?wt f8w3ҋEԉGHhHHэH[HHsHHHHˊHaHHHHHHHH$H$H;HHϕHHcHHHHHHHH`HHHHH{HvH\H;HHHHHH|HXH HhHHH°HHH[@h@h@HH|HۮHgHH5HFHaH|HHHŴH H޴H޴HHHZHHEHѳHH; QQQQQ3ndRH>-PCRE* MEP\t/}| UM B}~);}%ff#f;u K{ s u{}  suEEE=<=Džt,t0wwtt uy  Dž ~*%f<Dž$f>Dž$f<@tPoDž JȸVUUU;y<PܽKuFEpHf;w <}M΋JyIɀAEIf JfEyf;w Ekb΋JyIɀAEIf JfE#}E;E $Et+u$QP  $2M?+;w&ff;;usff#f;uE;tM}u;Esp $Et&j$QP uB $*M?+;wff;t E;rM};f;Uf;UE;rU};};}M t.;v}u$QRЋoR ]MP$E;r8+ff; M M U};fEf#EEf;Eu};>M f t ;}f? };}s Mt&;vnj$QRЋfQ uXF$E;rL+ff;H MU};rM3 ; 2;;;Eڃ}LEE؋E8-$H}04}U;xt9;Uu$QuMM j ~$E +M;w0ff;% ?M 1oBaM3IM KM]~"U}؋E++8H~+pS|!PPEPT* 9u~M K;3U<};~ ;+IAEHi@HHi@A## HE3;sf9YtzM 9zE 8B9BE ,;"3҃ v tBt׍;NjE;sf9Ytܕ p ^ L < 0 @ N b x Ҕ  * D T ^ l  z z z { { 0{ F{ Z{ z xz z  ̓ $ > x n b V T d r ~ J 6 (    Ғ Ē .} P} @} @ L ^ j r           4 @ L ` z Ԁ   " 6 R d v ~ ځ   * @ \ l | ʂ ڂ  " * R j z ƒ ԃ & D ` ~ ҄   * > V h z څ   . < T \ r ̆ ކ  ~ ~ ~ ~ ~ j~ ^~ L~ $~ ~ }   : ~ ę ҙ  * 6 H R ^ j z Κ ܚ  ( 8 J V f x ƛ   ́ ( { { { ~{ &'%M  ) } Η | f R <  Ж Ď Ԏ  " 8 H X j x ʏ   2 @ N ^ j v ֐   $ 0 < L Z d | ґ V H ,   ، Œ ^ N : &  z t f X J 8 *   ܊ Њ Ȋ v b V D 2 "  Ή ‰ t b R F 6 &   ܈ ̈ r \ D t b J 8 $  ڍ ƍ t 6 $  ڇ t f R < . ʋ h } } } p} } z z y | { { | | 2| D| p| | | | | \| | :z Zz Hz s  t o 49  . @ R j Θ  8 F ^ t {GGGGGGGGGG B|MBeBqBBm*Cb|B oCMBfS x' x FFFF/F F FF444#N-+. {20 FFFFFFFF Fż"hN@GpǼ"hN@GpFZ܊M`* 'K9AgBbad allocationmscoree.dllCorExitProcessRoInitializecombase.dllRoUninitializefmodtIBB?BBBB?BB=B=BgB=BBB?BB??330C??33am/pma/p'KygBgBUnknown exceptioncsm (KnhBtHHHHja-JPzh-CNko-KRzh-TWSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPMMM/dd/yydddd, MMMM dd, yyyyHH:mm:ssSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPMMM/dd/yydddd, MMMM dd, yyyyHH:mm:ssen-US  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~kernel32.dllFlsAllocFlsFreeFlsGetValueFlsSetValueInitializeCriticalSectionExCreateSemaphoreExWSetThreadStackGuaranteeCreateThreadpoolTimerSetThreadpoolTimerWaitForThreadpoolTimerCallbacksCloseThreadpoolTimerCreateThreadpoolWaitSetThreadpoolWaitCloseThreadpoolWaitFlushProcessWriteBuffersFreeLibraryWhenCallbackReturnsGetCurrentProcessorNumberGetLogicalProcessorInformationCreateSymbolicLinkWSetDefaultDllDirectoriesEnumSystemLocalesExCompareStringExGetDateFormatExGetLocaleInfoExGetTimeFormatExGetUserDefaultLocaleNameIsValidLocaleNameLCMapStringExGetCurrentPackageIdR6008 - not enough space for arguments R6009 - not enough space for environment R6010 - abort() has been called R6016 - not enough space for thread data R6017 - unexpected multithread lock error R6018 - unexpected heap error R6019 - unable to open console device R6024 - not enough space for _onexit/atexit table R6025 - pure virtual function call R6026 - not enough space for stdio initialization R6027 - not enough space for lowio initialization R6028 - unable to initialize heap R6030 - CRT not initialized R6031 - Attempt to initialize the CRT more than once. This indicates a bug in your application. R6032 - not enough space for locale information R6033 - Attempt to use MSIL code from this assembly during native code initialization This indicates a bug in your application. It is most likely the result of calling an MSIL-compiled (/clr) function from a native constructor or from DllMain. R6034 - inconsistent onexit begin-end variables DOMAIN error SING error TLOSS error runtime error @HH `H HHXHHHXHHHHHDHH PH!H"HxHy0HzLH8KhHR6002 - floating point support not loaded Runtime Error! Program: <program name unknown>... Microsoft Visual C++ Runtime LibraryB   (null)(null)EEE50P( 8PX700WP `h````xpxxxxexppowloglog10sinhcoshtanhasinacosatanatan2sqrtsincostanceilfloorfabsmodfldexp_cabs_hypotfmodfrexp_y0_y1_yn_logb_nextafter???D???@?@W????w?A? ?@??q????@??}?N?@ ????m?A?????q?H?!?????a?Š#4<Xq?BJ=_D?mKF=Ԛ?s7E=@[-?K>d:=g?Z}=\uI=s~Q?g:"(N='?9~$O1=q?n1%=p)k?vʌ=`X:?q.W =Pi?g>M=[?ֲa M=_3?֍,uXO=`Ɏ/?1w<=>'eH?` JJ=x~? Š&=n`Y?˖C=0?]/=# g?uP= ?,lC=5q?ᕎ =@Dӳ?-[@=pt4z? فpnJ=l?i.Eg<y~??O^'=(Tt? x;;=P?RRF=&?XɣN=J@?~=Ht=c?AzU"=nB?U_lj7=]?qBD= h0"ؿ؍ IQn0ؿHn&E:׿E7D57A׿ %@@ֿ*Z+ASTֿrJD@ӑտNT?w3kտr19]ԿFKm8C!`Կ1y2Y@ Կ*(FEO5iѿ4Q!?: пC +pڌXпxO,C"пAri<q~_ϿR v== ~οo6@mPͿ d+>̿9Ȓ[\˿8B'&˿i[JZOʿbnEDE}ɿUgc@H ȿUZdL" ǿ=Dj!ǿVm:A@`3ƿ~%3kcſ"7M Ŀp>)%ÿ\Bjx¿#6HˆQ;`t-¿=]PH0;TaָE&a-#KV\ Vb4M@U@Xx55@캿D=iI^Gי'7AԷUNҪ1GƴO\C@+Bg:IB@Zu}M:(T!1n]vQ<)8h׾o$|f+x2S74U".mœFB*6IKS_ D 5M-Cz1}BKG c?OfFL,sX4I+xm w$VcE?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@?@??????????????????????@????@?? ? ?@ ? ? ? ?@ ? ? ? ?@ ? ? ? ?@ ? ? ? ?@ ? ???@????@????@????@????@????@????@????@????@??|)P!?Ua0 !=+34?2Q =`??7; WJ=`7E?'a%C=MkK?*b<=0ɘP?*,z?=d|S?KT'K=R_V?bF=p^BY?E&= 9&\?߇N9=p _?߭Eb2]A=`?f#I=hb?O2H`3=c?e2a1=ԆLe?2RM=f?A3_:=@0h?[2ieO=i?1rK=k?Σ-=l?̈[8=yQm?>|W8A=՛ko?>qݲN=np?z m{ M=t)(q?m,SD=E`q?}e?=ԩr?}~:fE=PSs?&A=& t?,&8=tt?eѴN@=PSu?^p?o40=!9v?W?N=<v?+#GYM=Hw?qC@=Pex?0 &ے=Xy?8=<8y?!({=H= z?d,GB=6K{?ҝE M=¾|?w31!=L|?^X-F=Dfqsg~7(7s6uE(ruv.E,t]rLvOrȚ p&qC"5FzIqoOjpO|Wp Ȯ/N#D5pO/3N^o I!` 1nDCE"Bnu ^!EWΉm--0lNpCP&`l™J$akN8xj[ -=8Riy~ La8i[٬zF+ghk<@8KHg}7ڒ%gmg1&3{4WfI8e}OA8ӌd_\MP4.dó6D@uc2I{bTWB`b.r}X]La6MŞr<P`;ƥIpη_v<-UF^9M\̢N3e[ݻk>? #JY&-DPZXm4I@@7eWO/jUIlNAi0TWq uIbR|m:K@VNQ?|G¾d0`7O84 fXLzB7CIp4"%H`/G: WI`ȃ1D/!H@%OAA9"Ix'8RؔN;*2]@G?E?@D?C?A?@?>?@=?;?@:?8?7?6?4?3?1?@0?.?@-?+?*?)?'?&?$?@#?!?@ ???????@??@???? ? ? ?@ ??@???????@??@?????@??@??@?????@??@???????@??@???????@??@???????@??@???????@??@?????@??@??@?????@??@????????@????@????@???@????@???@????@???????@????@???@????@???????@??~?~?@}?|?|?@{?z?y?y?@x?w?v?@v?u?t?t?@s?r?q?q?@p?o?o?@n?m?l?l?@k?j?j?@i?h?g?g?@f?e?d?d?c?b?b?@a?`?_?_?@^?]?]?@\?[?Z?Z?@Y?X?W?W?V?U?U?@T?S?R?R?@Q?P?P?@O?N?M?M?@L?K?J?@J?I?H?H?@G?>Y"G=>.ܶlWE=>jۋbH=>^IL#=>(i&I=h>gݟP'E=p>*)D=>&N=x>.;ĝ@=H >Qyu3= >c-=@>Rݡ:==> {M= @>C=` >bߔB= >tdC=$ >9O=>B NC=>j&==>.<=@>`lrG=>!ls1= ?8= @? mN=&?UtQ$=X?PiB{^C=?Gv72=@?qlm+=?!.j7/=d?L C=`?m +=P ?5Od% =?r<(?*Hga2=@ ?CI=r ?sA=* ?GTiA= ` ?KՋD=r" ?Dp`q=L$ ?~G=4& ? D='@?E=)?'P<+?f4±cC=@?qWn{;=?gC i8=?XKD=P?G;R"=7?8΁3,'1D=B'@?:+NB=(?1z@J=*?3=+`?wU4?=,?DO=;.?$b=/p?g)([|X>=H1?>gV=20?OBO=*4?bPA<5?e4=f7@?|[{~*L=9?ٹE=t:?G]C='"?@(6F=? #?'A=@H#?43 A=Ax#?uN}*J=C#?)r7Yr7=]D#?.K="=rE$?r =F0$?3=1Z1=H`$?h|=G=gI$?ܩN:=J$?4e 6=K$?{<9==M%?uYPwH=NH%?-*8=Px%?yF.=-Q%?\9 ;,=R%?29Zd@=T&?~YK| =sU0&?WĻ(J=VX&?RIG=X&?W N=Y&?g'9=[&? D"^=2)$7bmLMӿ( ԏS4_ >L|/ dM4g±82qڜ1ןqaPCQo%;9?_0Cw4g%6L&M;k@ڿ81ABۏ1uB)_ Y/󓎣,:x.Ճ^-?ޯԝI-:]=O>O#w_jُBn(+E -V~|_B}_ACK!ܨY:_5Gt/C$>#Hm- MVn@QU^tA$OÄþiM@K8|;2@(AV64oꬠTC9?&u.~Fs:4Կ J_L II=@0(ן$.G?}3Rʏ3 !|.4*ڟ ඄}3? G"jm >; *O 0 :O 2K;޿ Q`4_  ZD 69* F_ T3ʢK M.֢> @_@? 1\hUXpM&Jx3Ҭx/h 78Lv]EV 3Bv9r_cM*5&Lq3?:R$@܎$=K'\?Ъ{b>$EvCIw8R'FG_j,)+jBD|_ `kA%'r BL TE_GO#i# ;^طH?6(`JJ\HB5``.11\?QDTӾ96оk< xE˾CqTR;ǾdG GgL@_h %? SS@b?Wdy>c*GPAiFC.ֿ?53=?͸)a,?][SqnC?nwtӰY?eus<)kp?&<ߑțuE?Ka<>?5a1xH<lX? aJ.?#Eq<1 ?1j<1Lp!?|眊<dD8`<;f?Ud4ݛ u? gVr/eT'?*mb|L%?2L#FG?AֈDh?ԛƟfNJ?:|”<۠*B?&KVU?An/X0y?c~˛@@ccsUTF-8UTF-16LEUNICODE8C8C0<0<+eGW@+eGW@B.?B.?:;=:;=ѱt?ZfUUU?&WU?{?Mu{<`w>,g5RҌ<2ؼcnQU Zsnim?Lyc>=*p%??C;0=|?Ix"<=`` ә?yM==orO?+C==v?R1=PQ ?Ӏb=@P?5M[g?=V?d+[7=?nB>= kz*?w#8=0nط?C#7={?D i00=ˮf?j -=x)?}z= ? 0$=HV?o=X a?;M_8=@? 5=?^@'=L$?/r(==ɥ%?Nl,"=@\r??t8=85R?ӇӜ=L. ? >)g=Ը3U?Ӱ== ?hXg+=og?X=ذ0?{fHn=<w?y5s3R6=)?a8< O4W?4bV0=L?4@=@?Xۓ4=Tk?>_(=?*o=@[c?,=$4b?dO"=lx?#608=ě&m*?ɉh"0=בl?n6ѯ{<9[P?cezb<$?F 8"=8B.?0gǓW.=-DT!?-DT!RUUUUU?vF$I?ɿ3YE?#Yqn?; 9/I?hKd?81UH!G?#$0|f?KRVnTUUUU?~I$I?gɿHB;E?q{雮?x֚? @ @??@>1|MC8C8CX<1 "?';<ï&b?,kg<!J?ĂeT1<1y"?z<F#?Va<$ lc? x<nu?cv5<?0N<ߢ#? "$<bm d?gQ<|a7?麏<ac? 0 H_<А$?]U ?<8Ud?|}}?<5盧?~+< ?)0>B<'HR%?I&<^:ȅe?>!ʎ<sl?ecb~q<ۧ?rʀ<F(&?Zn<'`f?47j<㚦?+i U<oX?F.K;<.'?Yhʼn<4lkQg?;+U<3?М m8<&?<S(?Y=t<:@Xh?,n@4`<$?<n?9ܮ<-)?\<Řwi?=<R%é?f@<*B?aw<G^*?m(<<2;j?PE<?Ҳ?<w*I?n'$<23?z7<[>t?V-Ai<?`DTb< ;?S.<TR*?)R<2k?,%ً<r?SC? <H?Zxgf<`/-?#<މ7m?w <悆a?_"C<lX^?@<{Х/?$8^<]hNp?bX*<?}_Ͼ<s?pt<hf2?$V<4{#s?Ug <?w<J.?IZ <*Ow5?.@<FHv?N <!?j<v(?z"<i68??!<Uۊ<o]2'?I<Рi?G<o? Ιn<9[? |^<.?>oj<._p?1S<X?l<~?o.x<%3d?{=4 L?V!=b#?@g = a?Gz =]ư?6 =oJV?J b='4?/t><w?a`<_?a e=F``?/f =#&?5SmT4<W?Rz< ъ(?vY<k?pY. =y?8'<KuC?j<{ =2<5?ýd =x?"a =@ic?%[9=?kRF<6DC?ş ܬ_<5Z?ȡk*=3?*+xi(<G&?r ly=:3S?z j<[?'<;!?h=<?:<sd?3 =? ?{!mB<<>? *2=2?cMyoG=Vsw?8K$<}?Cl<Ϲ?-<'F?ɕ{<$R?܊)B<#?<c?? ~<F]?&= /?94E<? T9?9* )<l?e/?B6!F=u0wu?M떐 =k`(?<4=?Kp=G"zI?$}Tw5< [?ߪb<Ka?aF7=V j?Ty<R߂e?M]-e<$[?3<Ễ?QZo =n6)}?, ,?؏?M?x%q? ?/xbJ?Ȉb?uÏ?(Z?t?{}2F??_2?>T^?u ??4td? Z?( ?WIY?d?{?|:?S9?s? ?K???l.?Z3?;E?2:@?>?@@?"Ir?64?@Û??765@Z?&+-?w'?Q?Gpt?2&?X9Ш?Bq?/? ?vɛ?Mj$?3?s? b里?V?% S?Vѩ?ߖ%@?U>?2,|?ܜm?Vkށ?9?I@|?P3y??}>v?H|As?#?(b;?탿7?]o-4?Ph0? H,?:5)?Iٓ\%?f,!?갸%?N?$k?oay?*??Y ?$??(?a?9y?9 9R?%R?F?@I?j T?0ұR?VDD?oWsg6?UJ(?>t?2̄λ ?1_?$*2?[ێ?N)?V?l$G~ٮ?+6?tF4؎?,~?"n?<փ]?|ߠL?l6;?6**?|59?:?HK?s7 ?I-?$z?9\?>|.~?-W?^\sY0?:Rp7?mbzA?G4's?IyȊ?%=_?C\2?Ou?m.?M?nw?KK'F?l^?:" ?Ѭ?}6lw?:@?7Z8> ?$ f?e')lW?zD@ [?jq?PJ?FB<'HR%?I&<^:ȅe?>!ʎ<sl?ecb~q<ۧ?rʀ<F(&?Zn<'`f?47j<㚦?+i U<oX?F.K;<.'?Yhʼn<4lkQg?;+U<3?М m8<&?<S(?Y=t<:@Xh?,n@4`<$?<n?9ܮ<-)?\<Řwi?=<R%é?f@<*B?aw<G^*?m(<<2;j?PE<?Ҳ?<w*I?n'$<23?z7<[>t?V-Ai<?`DTb< ;?S.<TR*?)R<2k?,%ً<r?SC? <H?Zxgf<`/-?#<މ7m?w <悆a?_"C<lX^?@<{Х/?$8^<]hNp?bX*<?}_Ͼ<s?pt<hf2?$V<4{#s?Ug <?w<J.?IZ <*Ow5?.@<FHv?N <!?j<v(?z"<i68??!<Uۊ<o]2'?I<Рi?G<o? Ιn<9[? |^<.?>oj<._p?1S<X?l<~?o.x<%3d?{=4 L?V!=b#?@g = a?Gz =]ư?6 =oJV?J b='4?/t><w?a`<_?a e=F``?/f =#&?5SmT4<W?Rz< ъ(?vY<k?pY. =y?8'<KuC?j<{ =2<5?ýd =x?"a =@ic?%[9=?kRF<6DC?ş ܬ_<5Z?ȡk*=3?*+xi(<G&?r ly=:3S?z j<[?'<;!?h=<?:<sd?3 =? ?{!mB<<>? *2=2?cMyoG=Vsw?8K$<}?Cl<Ϲ?-<'F?ɕ{<$R?܊)B<#?<c?? ~<F]?&= /?94E<? T9?9* )<l?e/?B6!F=u0wu?M떐 =k`(?<4=?Kp=G"zI?$}Tw5< [?ߪb<Ka?aF7=V j?Ty<R߂e?M]-e<$[?3<Ễ?QZo =n6)}?, ,?؏?M?x%q? ?/xbJ?Ȉb?uÏ?(Z?t?{}2F??_2?>T^?u ??4td? Z?( ?WIY?d?{?|:?S9?s? ?K???l.?Z3?;E?2:@?>?@@?"Ir?64?@Û??765@Z?&+-?w'?Q?Gpt?2&?X9Ш?Bq?/? ?vɛ?Mj$?3?s? b里?V?% S?Vѩ?ߖ%@?U>?2,|?ܜm?Vkށ?9?I@|?P3y??}>v?H|As?#?(b;?탿7?]o-4?Ph0? H,?:5)?Iٓ\%?f,!?갸%?N?$k?oay?*??Y ?$??(?a?9y?9 9R?%R?F?@I?j T?0ұR?VDD?oWsg6?UJ(?>t?2̄λ ?1_?$*2?[ێ?N)?V?l$G~ٮ?+6?tF4؎?,~?"n?<փ]?|ߠL?l6;?6**?|59?:?HK?s7 ?I-?$z?9\?>|.~?-W?^\sY0?:Rp7?mbzA?G4's?IyȊ?%=_?C\2?Ou?m.?M?nw?KK'F?l^?:" ?Ѭ?}6lw?:@?7Z8> ?$ f?e')lW?zD@ [?jq?PJ?F ? c??-[6?N}X<?]݃?'Z4?e-CS?F?,w?(F_e?X2CQ? ُ㈏?wT?/VW?#(7? L?hC!߶?c(y?-˶?X1Uu??Y.<?PB?>SŎ?6 Ӷ?'P9?z^3? ΂?&1yA?(+_R?mY?}"?ƟlW?P),H?,b??@??c\5j?=Mpm?c+?BpVV?Q9V%?]|=3?.?|_P?%?ػZq\? ,6?5DKBӹ?@IK?Xf?v?'?+3?2y?g/p<?7C ??ED;?h7r?=?(r? EVw?У? ?0SM`??3?/*2?56Yz?Ʊ?Ge?4?%KV?rH?I,+?U&X>?i.?c4?? ?NT?j86?f*"!?~w"?nJR?17!?|GD|??*a?} Ũ<?ƼpAؒ?ZM$^@]>= @Z7@abK?؝Z@t?,@T4s?a g @XpM@D$_@n}in@)M@֐@P(*C? mz@E3&ԿfYeY!@,d&@#7̓B,@@=U&2@UUUUUU@9E47@ @}=m=@@ 8λB@[[@u+E6G@@?@ӸHO3oX ?% #Z."S- >Q!r?M%ᾎ;DŽ cd3>$9t?JyA]VJ]>Q䫢I?ZIο7t`=cH??ZS +ߏ?Y9m|1~-g>b/[E?8QSվ7KǓ>€p?[j3HX& CUx>XzvC?*ɿa#wi#:wB??x#qQ?L yaF5d>2*q?ɾ?c3yƟ0>q澺k?g\>{O>>u>=?)IſX3{9lf??V}X9܈?+*tsJEX*yhU&>3H?ܨ9ԪFr>)(g?VtFcfy>?p6?K=3il??Kk0vB-G? 8dlMV>|s`?Pt"!k?JI>΃+תd?s{c|HY"?X:n>//2?6G^#f??dčDo=z>-Bվy%#(A>ō:?S/|o3fW|aD `N>Fb?kt LR3ec>Df/?@b̰kع??"])E}>r>ľ>nzru>Cԑ?lf6 noP"Q?m˹A>fǰa?+kWZbI#݄,[>=h,?nĠ}P=Ȣ_??+j>&D(>ll?bIJm>gjVa?\yNW> 4w+?UUUUUU??"])>E}>r>>>nz?ru>Cԑ?lf6 n>oP"Q??m˹A>fǰa?+kWZb>I#?݄,[>=h,?nĠ?}PȢ_??dčD?o=z>-B>y%#?(A>ō:?S/|>o3fW|a?D `N>Fb?kt> LR3?ec>Df/?@b̰?k=ع??Kk?0vB-G? 8d>l?MV>|s`?P>t"!k??JI>΃+תd?s{c|H>Y"??X:n>//2?6G?^=#f??V}X9?܈?+*tsJ>EX*?yhU&>3H?ܨ9>ԪFr?>)(g?V>tF?cfy>?p6??K=3=il??x#?qQ?L ya>F?5d>2*q?>?c3y?Ɵ0>q澺k?>g\>{O?>>u>=?)I?X3{9=lf??ZS +?ߏ?Y9?m|1~?-g>b/[E?8QS>7K?Ǔ>€p?[j3H>X& CU?x>XzvC?*?a#wi#:=wB??ӸHO3?oX ?% ?#Z?."S- >Q!r?M%>;DŽ? cd3>$9t?Jy>A]?VJ]>Q䫢I?ZI?7t`cH??fYeY!,d&@#7̓B,=U&2@UUUUUU@9E47 }=m=@@ 8λB[[u+E6G@@@ZM$^]>= @Z7abK؝Z@t?,T4sa g @XpM@D$_n}in)M@֐@P(*C mz<@E3&ԿI,+U&X>?i.c4? ?NTj86f*"!?~w"?nJR17!|GD|??*a} Ũ?ƼpAؒ?߿ED;?h7rۿ=(r? EVw?У׿ 0SM`??3?/*2Կ56Yz⿛Ʊ?Ge?4%KV<?rH?BpVV̿Q9V%?]|=3ſ.߿|_P?%?ػZq\ ,6ڿ5DKBӹ?@IK?Xf䵿vӿ'?+3?2yڿg/p?7C ?>SŎ6 Ӷ?'P9z^3տ ΂?&1yA?(+_RmYп}"?ƟlW?P),H,bſ?@??c\5jӿ=Mpm<?c+?'Z4e-CS?F,wʿ(F_e?X2CQ? ُ㈏wT¿/VW?#(7? LhC!߶c(y?-˶?X1Uuɿ?Y.?PB?_CN?Fn 棿 c??-[6N}X?]݃?m0_$@m0_$@xC8C@DT!?DT!?@gg2LL#F=J47ࢨ:Esp.:3gg2=?`C<<?1mm.s,)?'>?i i1mm.s?,)'><i? i<ȿmb<Z" ?.ҿu<ϕk|?c}ؿ,g<ysh:?;8]+޿ ^ty[g?h9; %S ? %L jh2yʿ;f 4݋<Xw$3Ak ł<࿇暳s)f09N,J?8v<uZEeu?F2k Wt-v1-VA`пgY?\ϗb buпP/Ye?&%ѣ@}<P/Ye&%ѣ@}<?gY\ϗb bu?-v1?-VA`?uZEeuF2k Wt?N,J8v<?暳s?)f09?Xw$3?Ak ł<?2y?;f 4݋<?S Ϳ %L jh?ty[gſh9; %?ysh:;8]+޿ ^?ϕk|c}ؿ,g<?Z" .ҿu<?i i<ȿmb<?1mm.s,)'><?UUUUUUſ?UUUUUU?*llV4V>>m0_$@8C`a=`a=@T!?sp.c;`C?i i1mm.s?,)'><i? i<ȿmb<Z" ?.ҿu<ϕk|?c}ؿ,g<ysh:?;8]+޿ ^ty[g?h9; %S ? %L jh2yʿ;f 4݋<Xw$3Ak ł<࿇暳s)f09N,J?8v<uZEeu?F2k Wt-v1-VA`пgY?\ϗb buпP/Ye?&%ѣ@}<P/Ye&%ѣ@}<?gY\ϗb bu?-v1?-VA`?uZEeuF2k Wt?N,J8v<?暳s?)f09?Xw$3?Ak ł<?2y?;f 4݋<?S Ϳ %L jh?ty[gſh9; %?ysh:;8]+޿ ^?ϕk|c}ؿ,g<?Z" .ҿu<?i i<ȿmb<?1mm.s,)'><?UUUUUUſ?UUUUUU?*llV4V>>m0_$@8C`a=`a=@T!?sp.c;`CI?I@IAICIDIFIGIIIJȡIKСINءIOIPIVIWIZIeIIII(IH4I@ILIXI H dI pI |IIIItHHIIĢIТIܢIIII II$I0I \I?hI@tIAICIDIEIFIGȤIIԤIJIKILINIOIPIR(IV4IW@IZPIe`IkpIlIIIHI I I ȥIԥIIIIII,(I;@I>LICXIkpI I I I I I I ȦI; Ik IIII  I ,I 8IDI;PI`IlIxI I I II;IЧI ܧI I II;I(I 4I @ILI;dI tI I I; I$I $I $I;$̨I(ܨI (I (I,I , I ,I0$I 00I 0II7̭I`I حINxI/ItIIIZhI IO@I(IjI IapI,IPxI8IDIQIPIRhI-\IrI1hIxСI:tIII?IISI2Iy(I%Ig I$IfIXI+̮ImخII=IءI;II0IIwIu IUI,I8ITDIIPII6\I~IhIVItIWIIIIIIXIȯIYI<ԯIIIvIȠII[I"IdI,I?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~( Lx LAUSER32.DLLMessageBoxWGetActiveWindowGetLastActivePopupGetUserObjectInformationWGetProcessWindowStatione+000EEE00P('8PW700PP (`h`hhhxppwppCreateFile2U?wB%K=?[?(6Ng=?$?V`t>?տ?2n{a>?? M=?H{? {4r>?Pא?"">?u[?* >??G0_(>?4wb?i^^?(>?0?p3>?@?FM>?8M?BV>?d?}Ba.>?ȴ ?d>?g?ߊ>?@?f\*>?~e?-f>?]%?D G?>? ?\>>?X?1 #>?E?h>???ⳇ>??$ 49>?x8?k0H<>??rش8>?8fm?"m>">?ħ?[?k?"%>??݉@fR8>??T:>?T!?3&F >??<[#>?%?Y:/(A6>??N2>?8O?r!' >?r?8{K>?p?9l9$>? G?aj i9>?T|?'\|#<>?$?}dj#>?Wn?׈MVx:>?,?18o,>?D$? c/ >?@ |?x7|1>?|?9>?p #?IAu=>? s?xٴ4>?p?edf&.>?,?fA>?h*?v2>?$gN?RE\K>?q?'^IE>?DΒ?&aH>?L?&KrQF>?,?#/'>?إ?]Xc?>??Ԯ}>?e.?IdWA>?K?ΐ?>?Xg?4*A>?_?[džJ>??10H>??hc#]G>@,*?Qx F>@@p?ekR.N>@?Ӿn@>@b?O>@$Q/?CJO>@@E?G>@[?3E{A>@Tp?SfIS:>@X΅?B6)1<>@@3?>ځ7>@$?s(N>@@?V 6f=>@(?{>@@(W?-Jg >@?"aPK>@xm ?,Sڤ6>@?6hb">@@-?k,<>@X>?0=>@O?׀IXH>@-_? @>@@n?2E>@P~?=ő8>@lj?[j&,>@L7?x82>@@?c#VB>@0?7ڨ.Y>@P?[p&>@ؔ?h4MA>@@?EplE>@+?o$E>@h?\*K>@?-?B>@@P8?(l|@>@p!?u@J>@@p-?V1> @89?5>@ @ @h)P?R`DOG> @T[?9%K> @Mf?/<>@ @q?Ò?> @{?42G<> @L?Â|/> @Y?s @>@ @k?Òa@> @XS?x(3u8> @?vO,ib> @ȥ?&L͒C>@ @?}L> @X?Lo> @x?-Ϡ9> @s?6FID?9>@ @8J?gsL> @d?y> @?>&09C>@? @@(J?IV C>@`w?^@N>@?#%@>@s?MK>@@D'?ήQ->@.?9 !G>@6?.1>@>?.1NcB> @cE?sǔ1>@@LL?nHN>`@HS?W$>@8Z? Ȃq;>@a?N/[7>@(h?=mC>@0oo?H75M>@Hv?P.#> @|?G7>@@*?#42I>`@?ooJ>@?-#>@?h% F>@@?Rx^D>@PP?s@>@4L?P_! #> @4?:#G>@@L?qg:&J>`@Hɹ?5L$.4>@\w? !1C>@? [<>@D?<=@? ~=@y?B> @?~.4>@@h?u|8>`@E?A8yL;>@h?41C>@{?-+oF>@$?xO>@s?՝mT2>@W?=> @-?î\=>@@?\==`@ ?j\&">@X? 1D>>@?#O#`I>@?}0>@?F\IE>@t{#?ׯ,B> @0'?E ]$>@@,>,?ކ?5>`@0?iIqE>@4?ha;>@9?AD>@.=?̤KFw=@DMA?=@`E?apI0H> @gI?:->@@cM?%Q>`@@UQ?Ly5ښoE>@;U?vg0/>@Y?jv UG>@\?yK>@,`?A%My>@md?H> @ h?pM>@@0k?k}<>`@ho?f7O>@r?}O>@v?+ iI>@@z?bB'=>>@`}?ZM>@?1M> @a?R~=@@t?QNT B>`@x?W3cL>@ g?+(=@D?qJK>@L?;,*>@8!?D>@,O? E> @Du?in]D>@@?%3F>`@P?^F"VM>@?}30}->@@?~F y;>@?l R(>@躰?\7`>@?dg;> @?;Sv@E>@@<|?M>`@Y?|};2>@,0?@$?̯/p">@?\(0>@|?[s$F>@I?dӔV> @T?0)LK>@@h?)5G5>`@XY?|zJ>@@?W޾L?>@0?6:>@<3?QB>@x?7o/M>@Q?KcZ0> @?z-A5>@@Z?"BDcI>`@?`I.>@ L?Ld%>@ ?"l"w =@(??!>@?j^J>@8?ϞH0> @LL?%C>@@T?J+N>`@d?;l>0>@B?^{v@>@Ȋ?@Y˕B>@@?Tl0>@ ?w4n4>@G?oN=;> @h|?L{/>@@< ?Bnu5>`@ ?`,+>@d? 5>@$?l >@C?~+^M>@^?PKQD>@,u?^{#tF> @|?^4K >@@?4O >>`@?XEړ J>@?(gԹ,>@ ?43-spF>@"?P`E5+*>@$?=Q QD> @-DT!?\3&><<!==!=[]operator->*++---+&->*/%<<=>>=,()~^|&&||*=+=-=/=%=>>=<<=&=|=^=`vftable'`vbtable'`vcall'`typeof'`local static guard'`string'`vbase destructor'`vector deleting destructor'`default constructor closure'`scalar deleting destructor'`vector constructor iterator'`vector destructor iterator'`vector vbase constructor iterator'`virtual displacement map'`eh vector constructor iterator'`eh vector destructor iterator'`eh vector vbase constructor iterator'`copy constructor closure'`udt returning'`EH`RTTI`local vftable'`local vftable constructor closure' new[] delete[]`omni callsig'`placement delete closure'`placement delete[] closure'`managed vector constructor iterator'`managed vector destructor iterator'`eh vector copy constructor iterator'`eh vector vbase copy constructor iterator'`dynamic initializer for '`dynamic atexit destructor for '`vector copy constructor iterator'`vector vbase copy constructor iterator'`managed vector copy constructor iterator'`local static thread guard' Type Descriptor' Base Class Descriptor at ( Base Class Array' Class Hierarchy Descriptor' Complete Object Locator'CONOUT$1#SNAN1#IND1#INF1#QNAN.!AutoIt v3edit>>>AUTOIT NO CMDEXECUTE<<<CMDLINERAWCMDLINE/ErrorStdOut/AutoIt3OutputDebug/AutoIt3ExecuteLine/AutoIt3ExecuteScriptTaskbarCreatedAutoItMCWM_GETCONTROLNAMECCQC NUMBERCC\\Include\IncludeSoftware\AutoIt v3\AutoIt #include#pragma compile#notrayicon#requireadmin#OnAutoItStartRegister#include-once#comments-start#cs#comments-end#ceO@#DALTBACKSPACEBSDELDELETEDOWNENDENTERESCESCAPEF1F2F3F4F5F6F7F8F9F10F11F12HOMEINSINSERTLEFTPGDNPGUPRIGHTSPACETABUPPRINTSCREENLWINRWINSCROLLLOCKNUMLOCKBREAKPAUSECAPSLOCKNUMPAD0NUMPAD1NUMPAD2NUMPAD3NUMPAD4NUMPAD5NUMPAD6NUMPAD7NUMPAD8NUMPAD9NUMPADMULTNUMPADADDNUMPADSUBNUMPADDOTNUMPADDIVAPPSKEYLCTRLRCTRLLALTRALTLSHIFTRSHIFTSLEEPNUMPADENTERBROWSER_BACKBROWSER_FORWARDBROWSER_REFRESHBROWSER_STOPBROWSER_SEARCHBROWSER_FAVORTIESBROWSER_HOMEVOLUME_MUTEVOLUME_DOWNVOLUME_UPMEDIA_NEXTMEDIA_PREVMEDIA_STOPMEDIA_PLAY_PAUSELAUNCH_MAILLAUNCH_MEDIALAUNCH_APP1LAUNCH_APP2MOUSE_LBUTTONMOUSE_RBUTTONMOUSE_MBUTTONMOUSE_XBUTTON1MOUSE_XBUTTON2CTRLDOWNCTRLUPALTDOWNALTUPSHIFTDOWNSHIFTUPLWINDOWNLWINUPRWINDOWNRWINUPASCExitScript Paused:;<=>?@[\]^_` (((((       !!!"#$%&''!()*'+,-./!-01233!!3445!!6789:;<=>?@!ABCDEF!!!!!!!GHIJJKLMNOPQR!SS!T!U!!!!S!!V!WX!YZ![!!!Z!\]!!^!!!!!!!_!!`!!`!!!!`abbc!!!!!d!!!!!!!!!!!!!!!!!!!!!!!!!!!!eeeeeeeeefffffffffffffffffffffeeeeeggffhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhihhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhjkjkfljkmmnooommmmmlpqqqmrmsstuvuuwuuxyzu{uuu|}m~uuuuuutjkjkjkjkjktjkjkthhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmfhhhhhhhhhhh hmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm     mm mmmmmmmm mmmmmmmm  mm                mmm mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm                !!""""""""""##########!!!$%$%&&mmmmm!!!!!!!!!!!!!!&!!!!! !!!!!!!!!!!!!m!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!m!m       mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm'''''''''''''''''''''''''''''''''''''''''''(())))*))))))())**))'++++++++++,,,,,,''''''**))'''')))'(((''((((((('''))))''''''''''''')(*))(((((()'(++++++++++((();;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<;;;;;;;;;;;;;;;;;=>>>>>>>>>>>>>>>>>>>>>>>>>>?@mmmAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBBmmmmmmmmmmmmmmmCCCCCCCCCCCCCmCCCCDDDmmmmmmmmmmmEEEEEEEEEEEEEEEEEEFFFmmmmmmmmmGGGGGGGGGGGGGGGGGGHHmmmmmmmmmmmmIIIIIIIIIIIIImIIImJJmmmmmmmmmmmmKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKLLMLLLLLLLMMMMMMMMLMMLLLLLLLLLLLNNNONNNPKLmmQQQQQQQQQQmmmmmmRRRRRRRRRRmmmmmmSSSTSSSSUUUVmWWWWWWWWWWmmmmmmXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXmmmmmmmmXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXUXmmmmm;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;mmmmmmmmmmZZZZZZZZZZZZZZZZZZZZZZZZZZZZZmmm[[[\\\\[[\\\mmmm\\[\\\\\\[[[mmmm]mmm^^__________``````````````````````````````mm`````mmmmmmmmmmmaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaammmmbbbbbcccbbcbbbbbbaaaaaaabbmmmmmmddddddddddemmmffgggggggggggggggggggggggggggggggghhhhhhhhhhhhhhhhhhhhhhhiijjimmkklllllllllllllllllllllllllllllllllllllllllllllllllllllmnmnnnnnnnmnonoonnnnnnnnmmmmmmnnnnnnnnnnmmnppppppppppmmmmmmppppppppppmmmmmmqqqqqqqrqqqqqqmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmsssstuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuustssssststttttsttuuuuuuummmmvvvvvvvvvvwwwwwwwxxxxxxxxxxsssssssssxxxxxxxxxmmmyyz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{zyyyyzzyyzyzz{{||||||||||{{{{{{}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}}~~~~~~~mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmm!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ttttteeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeennnnneeeennnnn!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!eeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeeenhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmmmmmmmmmhhhh!!!!!!!!mmmmmmmmttttmmmmmmttmttllllttmttlllttmmttmllltttttlllmmttmttllm emmemeeeeeeeeeeeeemmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm!!!!!!!eemmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm44444444444444444444444mmmmmmmmm4444444m4444444m4444444m4444444m4444444m4444444m4444444m4444444m  f mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm hhhh fffffmmmhh fmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmfffffffff!!e!!!!!!!!f!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmee!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm11111111111111111111111111111mmmmfmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm    mmmmmmmmm mm          mm    '''''''''''''''' ''''''---'(mmmm                                                          mmmmmmmmmmmmmmmmmmmmmmmm  mmmmmmmmmm444444mm444444mm444444mmmmmmmmm4444444m4444444mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm22222222222222222222222mmmm3333333333333333333333333333333333333333333333333mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm!!!!!!!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhmmmmmmhhhhhhhmmmmmmmmm m  mmmmmmmmm   fmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm    !!!!!!!!!!!!!!!!! mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhmm"""""""""""""""""""""""""""""mmm#################################################mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$m%%%%mmmmmmmmmmmm&&&&&&&&&&&&&&&&&'&&&&&&&&'mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm((((((((((((((((((((((((((((((m)************************************mmmm********+,,,,,mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm----------------------------------------........................................////////////////////////////////////////////////000000000000000000000000000000mm1111111111mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm222222mm2m22222222222222222222222222222222222222222222m22mmm2mm23333333333333333333333m455555555mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm6666666666666666666666777777mmm899999999999999999999999999mmmmm:mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;<<<<<<<<<<<<<<<<<<<<<<<<mmmmmm<<mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm=>>>m>>mmmmm>>>>====m===m===========================mmmm>>>mmmm>????????mmmmmmmm@@@@@@@@@mmmmmmmAAAAAAAAAAAAAAAAAAAAAAAAAAAAABBCDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDmmmEEEEEEEFFFFFFFFFFFFFFFFFFFFFFmmGGGGGGGGHHHHHHHHHHHHHHHHHHHmmmmmIIIIIIIIJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJJmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKKmLMLNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNMMMMMMMMMMMMMMMOOOOOOOmmmmPPPPPPPPPPPPPPPPPPPPQQQQQQQQQQmmmmmmmmmmmmmmmmRRSTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSSSRRRRSSRRUUVUUUUmmmmmmmmmmmmmmWWWWWWWWWWWWWWWWWWWWWWWWWmmmmmmmXXXXXXXXXXmmmmmmYYYZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZYYYYY[YYYYYYYYm\\\\\\\\\\]]]]mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm^^_````````````````````````````````````````````````___^^^^^^^^^__````aaaammmmmmmbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmcccccccccccccccccccccccccccccccccccccccccccdedeeddddddedmmmmmmmmffffffffffmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmgggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmiiiimmmmmmmmmmmmjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjjmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkkmmmmmmmmmmmkllllllllllllllllllllllllllllllllllllllllllllllmmmmmmmmmmmmmmmmmmmmnnnnnnnnnnnnnmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmohhhooooohhhhhhhhhhhhhhhhhhhmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!ppp!mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm mmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmqqqqqqqqqqqqqqqqqqqqqqqqqqrmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhmm          ! ! G !    ! ! G!   !       ! K ! ! K! y! ! ! ! ! ! ! ! ! ! ! O! ! ! ! a! ! ! ! ! ! ! ! ! ! 8! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ~! +*! ]! (*! ?*! =! E! G! *! *! *! .! 2! 3! 6! 5! 1! (! D! /! -! )! )! +! *! )! &! ! '! ! %!     t       & % @ ?   "  ;  &    3    /  7    +  C     " ; &  3  / 7   + C    " &  + /    3 7  & ;   ~ P           0                1 11 1 7 7 ? ? ? ? ? ? Y Y Y Y ^ ^ ^                         + + + + + + + 5 5 5 5 5 5 5 5 6 6 6 6 6 6      $ $ $ $ $ $ $ / / / / / 8 8 88 8 8     9 9 9 9 9 9 9 9 9 & & & & & & &  `           ( ( ( ( - - 2 2     3 3         % % % %% % % " " " " " " 4 ' ' ' ' ' '      Z Z Z Z Z Z Z = = = = = = K K K K \ \ \ \ E E E E E H H H H K     ! ! ! ?! ?! ?! A   J V d  p ~                 C! GA! K! ! ! ! !      0 ! ! ! ! ! ! ! ! ! !       : : : :              < < < U U U L L L L   N N N N ! u! Z! Z0 0 0 0 @ @ J J J J J D D D D I I I I S S S S S C C C C C & [ [ [ [ V V V V V V       #    F B ) )   ; ; * * * (  . , ,  P P P A A A G G a `     W W W M M R R Q Q X  ] ] ] ] ] ] T T T T Td d _ _ _ _ _ c c c c c e e e e > > > O b b b b       !"#$%&'()))*+,-./0123456789:;<=>?@ABBCDEFGHIGJKLLBMBBNOPQRSTUVWXYZ[\]^G___________________________________________________`___________________________________________________________________________________________________________________________________________________________________abccccccccdeefghijklmnopqrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstuvwxrstyzzzzzzzzzzzzzzzz{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{__|}~OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOGOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO______________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________________OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO____OOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOOO{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{{SsE`a&!Kk*!+!  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~>~~xSwapMouseButtonsControl Panel\Mouse%s0123456789ABCDEFANDORNOTIFTHENELSEELSEIFENDIFWHILEWENDDOUNTILFORNEXTTOSTEPINEXITLOOPCONTINUELOOPSELECTCASEENDSELECTSWITCHENDSWITCHCONTINUECASEDIMREDIMLOCALGLOBALCONSTSTATICFUNCENDFUNCRETURNEXITBYREFWITHENDWITHTRUEFALSEDEFAULTNULLVOLATILEENUM%.15gerbSCRIPTclose all@EXITCODE@EXITMETHOD@GUI_CTRLID@GUI_WINHANDLE@GUI_CTRLHANDLE@TRAY_IDABSACOSADLIBREGISTERADLIBUNREGISTERASCWASINASSIGNATANAUTOITSETOPTIONAUTOITWINGETTITLEAUTOITWINSETTITLEBEEPBINARYBINARYLENBINARYMIDBINARYTOSTRINGBITANDBITNOTBITORBITROTATEBITSHIFTBITXORBLOCKINPUTCALLCDTRAYCEILINGCHRCHRWCLIPGETCLIPPUTCONSOLEREADCONSOLEWRITECONSOLEWRITEERRORCONTROLCLICKCONTROLCOMMANDCONTROLDISABLECONTROLENABLECONTROLFOCUSCONTROLGETFOCUSCONTROLGETHANDLECONTROLGETPOSCONTROLGETTEXTCONTROLHIDECONTROLLISTVIEWCONTROLMOVECONTROLSENDCONTROLSETTEXTCONTROLSHOWCONTROLTREEVIEWCOSDECDIRCOPYDIRCREATEDIRGETSIZEDIRMOVEDIRREMOVEDLLCALLDLLCALLADDRESSDLLCALLBACKFREEDLLCALLBACKGETPTRDLLCALLBACKREGISTERDLLCLOSEDLLOPENDLLSTRUCTCREATEDLLSTRUCTGETDATADLLSTRUCTGETPTRDLLSTRUCTGETSIZEDLLSTRUCTSETDATADRIVEGETDRIVEDRIVEGETFILESYSTEMDRIVEGETLABELDRIVEGETSERIALDRIVEGETTYPEDRIVEMAPADDDRIVEMAPDELDRIVEMAPGETDRIVESETLABELDRIVESPACEFREEDRIVESPACETOTALDRIVESTATUSDUMMYSPEEDTESTENVGETENVSETENVUPDATEEVALEXECUTEEXPFILECHANGEDIRFILECLOSEFILECOPYFILECREATENTFSLINKFILECREATESHORTCUTFILEDELETEFILEEXISTSFILEFINDFIRSTFILEFILEFINDNEXTFILEFILEFLUSHFILEGETATTRIBFILEGETENCODINGFILEGETLONGNAMEFILEGETPOSFILEGETSHORTCUTFILEGETSHORTNAMEFILEGETSIZEFILEGETTIMEFILEGETVERSIONFILEINSTALLFILEMOVEFILEOPENFILEOPENDIALOGFILEREADFILEREADLINEFILEREADTOARRAYFILERECYCLEFILERECYCLEEMPTYFILESAVEDIALOGFILESELECTFOLDERFILESETATTRIBFILESETPOSFILESETTIMEFILEWRITEFILEWRITELINEFLOORFTPSETPROXYFUNCNAMEGUICREATEGUICTRLCREATEAVIGUICTRLCREATEBUTTONGUICTRLCREATECHECKBOXGUICTRLCREATECOMBOGUICTRLCREATECONTEXTMENUGUICTRLCREATEDATEGUICTRLCREATEDUMMYGUICTRLCREATEEDITGUICTRLCREATEGRAPHICGUICTRLCREATEGROUPGUICTRLCREATEICONGUICTRLCREATEINPUTGUICTRLCREATELABELGUICTRLCREATELISTGUICTRLCREATELISTVIEWGUICTRLCREATELISTVIEWITEMGUICTRLCREATEMENUGUICTRLCREATEMENUITEMGUICTRLCREATEMONTHCALGUICTRLCREATEOBJGUICTRLCREATEPICGUICTRLCREATEPROGRESSGUICTRLCREATERADIOGUICTRLCREATESLIDERGUICTRLCREATETABGUICTRLCREATETABITEMGUICTRLCREATETREEVIEWGUICTRLCREATETREEVIEWITEMGUICTRLCREATEUPDOWNGUICTRLDELETEGUICTRLGETHANDLEGUICTRLGETSTATEGUICTRLREADGUICTRLRECVMSGGUICTRLREGISTERLISTVIEWSORTGUICTRLSENDMSGGUICTRLSENDTODUMMYGUICTRLSETBKCOLORGUICTRLSETCOLORGUICTRLSETCURSORGUICTRLSETDATAGUICTRLSETDEFBKCOLORGUICTRLSETDEFCOLORGUICTRLSETFONTGUICTRLSETGRAPHICGUICTRLSETIMAGEGUICTRLSETLIMITGUICTRLSETONEVENTGUICTRLSETPOSGUICTRLSETRESIZINGGUICTRLSETSTATEGUICTRLSETSTYLEGUICTRLSETTIPGUIDELETEGUIGETCURSORINFOGUIGETMSGGUIGETSTYLEGUIREGISTERMSGGUISETACCELERATORSGUISETBKCOLORGUISETCOORDGUISETCURSORGUISETFONTGUISETHELPGUISETICONGUISETONEVENTGUISETSTATEGUISETSTYLEGUISTARTGROUPGUISWITCHHEXHOTKEYSETHTTPSETPROXYHTTPSETUSERAGENTHWNDINETCLOSEINETGETINETGETINFOINETGETSIZEINETREADINIDELETEINIREADINIREADSECTIONINIREADSECTIONNAMESINIRENAMESECTIONINIWRITEINIWRITESECTIONINPUTBOXINTISADMINISARRAYISBINARYISBOOLISDECLAREDISDLLSTRUCTISFLOATISFUNCISHWNDISINTISKEYWORDISNUMBERISOBJISPTRISSTRINGISTABLELOGMEMGETSTATSMODMOUSECLICKMOUSECLICKDRAGMOUSEDOWNMOUSEGETCURSORMOUSEGETPOSMOUSEMOVEMOUSEUPMOUSEWHEELMSGBOXOBJCREATEOBJCREATEINTERFACEOBJEVENTOBJGETOBJNAMEONAUTOITEXITREGISTERONAUTOITEXITUNREGISTEROPTPINGPIXELCHECKSUMPIXELGETCOLORPIXELSEARCHPROCESSCLOSEPROCESSEXISTSPROCESSGETSTATSPROCESSLISTPROCESSSETPRIORITYPROCESSWAITPROCESSWAITCLOSEPROGRESSOFFPROGRESSONPROGRESSSETPTRRANDOMREGDELETEREGENUMKEYREGENUMVALREGREADREGWRITEROUNDRUNRUNASRUNASWAITRUNWAITSENDSENDKEEPACTIVESETERRORSETEXTENDEDSHELLEXECUTESHELLEXECUTEWAITSHUTDOWNSINSOUNDPLAYSOUNDSETWAVEVOLUMESPLASHIMAGEONSPLASHOFFSPLASHTEXTONSQRTSRANDOMSTATUSBARGETTEXTSTDERRREADSTDINWRITESTDIOCLOSESTDOUTREADSTRINGSTRINGADDCRSTRINGCOMPARESTRINGFORMATSTRINGFROMASCIIARRAYSTRINGINSTRSTRINGISALNUMSTRINGISALPHASTRINGISASCIISTRINGISDIGITSTRINGISFLOATSTRINGISINTSTRINGISLOWERSTRINGISSPACESTRINGISUPPERSTRINGISXDIGITSTRINGLEFTSTRINGLENSTRINGLOWERSTRINGMIDSTRINGREGEXPSTRINGREGEXPREPLACESTRINGREPLACESTRINGREVERSESTRINGRIGHTSTRINGSPLITSTRINGSTRIPCRSTRINGSTRIPWSSTRINGTOASCIIARRAYSTRINGTOBINARYSTRINGTRIMLEFTSTRINGTRIMRIGHTSTRINGUPPERTANTCPACCEPTTCPCLOSESOCKETTCPCONNECTTCPLISTENTCPNAMETOIPTCPRECVTCPSENDTCPSHUTDOWNTCPSTARTUPTIMERDIFFTIMERINITTOOLTIPTRAYCREATEITEMTRAYCREATEMENUTRAYGETMSGTRAYITEMDELETETRAYITEMGETHANDLETRAYITEMGETSTATETRAYITEMGETTEXTTRAYITEMSETONEVENTTRAYITEMSETSTATETRAYITEMSETTEXTTRAYSETCLICKTRAYSETICONTRAYSETONEVENTTRAYSETPAUSEICONTRAYSETSTATETRAYSETTOOLTIPTRAYTIPUBOUNDUDPBINDUDPCLOSESOCKETUDPOPENUDPRECVUDPSENDUDPSHUTDOWNUDPSTARTUPVARGETTYPEWINACTIVATEWINACTIVEWINCLOSEWINEXISTSWINFLASHWINGETCARETPOSWINGETCLASSLISTWINGETCLIENTSIZEWINGETHANDLEWINGETPOSWINGETPROCESSWINGETSTATEWINGETTEXTWINGETTITLEWINKILLWINLISTWINMENUSELECTITEMWINMINIMIZEALLWINMINIMIZEALLUNDOWINMOVEWINSETONTOPWINSETSTATEWINSETTITLEWINSETTRANSWINWAITWINWAITACTIVEWINWAITCLOSEWINWAITNOTACTIVED DD9BECQCstaticCaretCoordModed1r0,2ExpandEnvStringsd0bExpandVarStringsGUICloseOnESCd1bGUICoordModeGUIDataSeparatorChard124cGUIEventOptionsd0r0,3GUIOnEventModeGUIResizeModed0r0,1023MouseClickDelayd10m0MouseClickDownDelayMouseClickDragDelayd250m0MouseCoordModeMustDeclareVarsPixelCoordModeSendAttachModeSendCapsLockModeSendKeyDelayd5m0SendKeyDownDelaySetExitCodeTCPTimeoutd100m0TrayAutoPauseTrayIconDebugTrayIconHided0#1TrayMenuModed0#2TrayOnEventModeWinDetectHiddenTextWinSearchChildrenWinTextMatchModed1r1,2WinTitleMatchModed1#3WinWaitDelayERROREXTENDEDMSECSECMINHOURMDAYMONYEARWDAYYDAYPROGRAMFILESDIRCOMMONFILESDIRMYDOCUMENTSDIRAPPDATACOMMONDIRDESKTOPCOMMONDIRDOCUMENTSCOMMONDIRFAVORITESCOMMONDIRPROGRAMSCOMMONDIRSTARTMENUCOMMONDIRSTARTUPCOMMONDIRLOCALAPPDATADIRAPPDATADIRDESKTOPDIRFAVORITESDIRPROGRAMSDIRSTARTMENUDIRSTARTUPDIRCOMPUTERNAMEWINDOWSDIRSYSTEMDIRSW_HIDESW_MINIMIZESW_MAXIMIZESW_RESTORESW_SHOWSW_SHOWDEFAULTSW_ENABLESW_DISABLESW_SHOWMAXIMIZEDSW_SHOWMINIMIZEDSW_SHOWMINNOACTIVESW_SHOWNASW_SHOWNOACTIVATESW_SHOWNORMALSW_LOCKSW_UNLOCKTRAYICONVISIBLETRAYICONFLASHINGSCRIPTFULLPATHSCRIPTNAMESCRIPTDIRSCRIPTLINENUMBERWORKINGDIROSTYPEOSVERSIONOSBUILDOSSERVICEPACKOSLANGPROCESSORARCHOSARCHCPUARCHKBLAYOUTAUTOITVERSIONAUTOITEXEIPADDRESS1IPADDRESS2IPADDRESS3IPADDRESS4CRLFCRLFDESKTOPWIDTHDESKTOPHEIGHTDESKTOPDEPTHDESKTOPREFRESHCOMPILEDCOMSPECUSERNAMETEMPDIRUSERPROFILEDIRHOMEDRIVEHOMEPATHHOMESHARELOGONSERVERLOGONDOMAINLOGONDNSDOMAININETGETBYTESREADINETGETACTIVENUMPARAMSHOTKEYPRESSEDAUTOITPIDAUTOITUNICODEAUTOITX64UNICODEMUILANG\\[\\nrt]|%%|%[-+ 0#]?([0-9]*|\*)?(\.[0-9]*|\.\*)?[hlL]?[diouxXeEfgGs]AutoIt v3 GUI]F[:<:]][:>:]]Q\EP??????$@@@HKUGP,K@'K'K|'KK'K'K'K|'KK@'K,K'KtK$(K4(K<(KtK@$(KޘCC(C C CC C CC CCVC֘C֘CCCDCC CSDSOFTWARE\Classes\\CLSID\\\IPC$This is a third-party compiled AutoIt script."runasError allocating memory.SeAssignPrimaryTokenPrivilegeSeIncreaseQuotaPrivilegeSeBackupPrivilegeSeRestorePrivilegewinsta0defaultwinsta0\defaultComboBoxListBox|SHELLDLL_DefViewlargeiconsdetailssmalliconslistCLASSCLASSNNREGEXPCLASSIDNAMEXYWHINSTANCETEXT%s%u%s%dLAST[LASTACTIVE[ACTIVEHANDLE=[HANDLE:REGEXP=[REGEXPTITLE:CLASSNAME=[CLASS:ALL[ALL]HANDLEREGEXPTITLETITLEThumbnailClassAutoIt3GUIContainerCCCTClC!CQCQCCCCCCDCCCCDCCCCCCCDCCCCCCCaCCDCCD8CCCZC CCCCCCCYCQC7CCCCCuCCDCWCFCCOEYCjCCC}CCCCC?CCC$CCGetNativeSystemInfoIsWow64Processkernel32.dllWINDESCRIPTIONDESCRIPTIONSOURCEHELPFILEHELPCONTEXTLASTDLLERRORSCRIPTLINERETCODERAISECLEARSTOPC.CCCCCMCC@COM_EVENTOBJjCCCCCYCCDllGetClassObjectUnRegisterTypeLibForUserRegisterTypeLibForUseroleaut32.dllRDDuDDlDDDcdeclnonebytebooleanboolshortushortworddwordulonguintlongintvariantint64uint64floatdoublehresultstrwstrbstrptrhandlehwndint_ptrlong_ptrlresultlparamuint_ptrulong_ptrdword_ptrwparamidispatchobjectstructclsidInterfaceDispatchQueryInterfaceAddRefReleasenDDD D D D D$()*+%s (%d) : ==> %s.: %s %s Line %d: Line %d (File "%s"): Error: . ^ ERROR Error: %s (%d) : ==> %s: %s %s Run Script:AutoIt script files (*.au3, *.a3x)*.au3;*.a3xAll files (*.*)*.*au3#include depth exceeded. Make sure there are no recursive includesError opening the file>>>AUTOIT SCRIPT<<<Bad directive syntax errorUnterminated stringCannot parse #includeUnterminated group of commentsONOFF0%d%dShell_TrayWndTHISREMOVEblankinfoquestionstopwarning Line: BUTTON#32770StringFileInfo\\VarFileInfo\Translation04090000DefaultLangCodepage%u.%u.%u.%u\*.**? alias PlayMestatus PlayMe modeclose PlayMeplay PlayMe waitplay PlayMeSeShutdownPrivilegeMIDDLEMAINPRIMARYMENUSECONDARY nulDD0x%pTrueFalse%4d%02d%02d%02d%02d%02dDefaultw+bEA06autwbFILEWow64RevertWow64FsRedirectionWow64DisableWow64FsRedirection"%s" (%d) : ==> %s: %s %s "%s" (%d) : ==> %s: ^ ERROR %4d%02d*.*..LPTallcdromremovablefixednetworkramdiskunknown:\closeclosedopen type cdaudio alias cd waitset cd door waitclose cd wait\\.\PhysicalDriveRemovableFixedNetworkCDROMRAMDiskUnknownSSDSCSIATAPIATA1394SSAFibreUSBRAIDiSCSISASSATASDMMCVirtualFileBackedVirtualREADYINVALIDNOTREADYREADONLYUNKNOWN%lu\??\%s.lnk.*RANOCT6QB~ۜC]_GUI_RUNDEFMSG<local>BEEnvironmentDISPLAYmsctls_progress32AUTOITCALLVARIABLE%d, $^[A-Z\d_]+$Ping255.255.255.255Int32Int64DoubleStringArrayDLLStructReferencePtrObjectBoolKeywordBinaryFunctionUserFunctionTableNULL Pointer assignmentIncorrect Parameter formatAUTOIT.ERROR_NewEnumget__NewEnumNull Object assignment in FOR..IN loopIncorrect Object type in FOR..IN loopNot an Object typeFailed to create objectInvalid parameterGetModuleHandleExWCALLARGARRAYVariable must be of type 'Object'.Invalid characters behind Object assignment!Variable is not of type 'Object'.%@Incorrect parameters to object property ! %.3d%S%M%H%m%Y%jX86IA64X64WIN32_NTWIN_81WIN_2012R2WIN_2012WIN_8WIN_2008R2WIN_7WIN_2008WIN_VISTAWIN_2003WIN_XPeWIN_XPInstallLanguageSYSTEM\CurrentControlSet\Control\Nls\LanguageSchemeLangIDControl Panel\Appearance3, 3, 12, 0USERPROFILEUSERDOMAINUSERDNSDOMAINGetSystemWow64DirectoryWSeDebugPrivilege:winapistdcallubytepEEGetProcessId64HKEY_LOCAL_MACHINEHKLMHKEY_CLASSES_ROOTHKCRHKEY_CURRENT_CONFIGHKCCHKEY_CURRENT_USERHKCUHKEY_USERSHKUREG_EXPAND_SZREG_SZREG_MULTI_SZREG_DWORDREG_QWORDREG_BINARYRegDeleteKeyExWadvapi32.dll+.-.-(*UCP)\XISVISIBLEISENABLEDTABLEFTTABRIGHTCURRENTTABSHOWDROPDOWNHIDEDROPDOWNADDSTRINGDELSTRINGFINDSTRINGSETCURRENTSELECTIONGETCURRENTSELECTIONSELECTSTRINGISCHECKEDCHECKUNCHECKGETSELECTEDGETLINECOUNTGETCURRENTLINEGETCURRENTCOLEDITPASTEGETLINESENDCOMMANDIDGETITEMCOUNTGETSUBITEMCOUNTGETTEXTGETSELECTEDCOUNTISSELECTEDSELECTALLSELECTCLEARSELECTINVERTDESELECTFINDITEMVIEWCHANGEGETTOTALCOUNTCOLLAPSEEXISTSEXPANDmsctls_statusbar321tooltips_class32%d/%02d/%02dbuttonComboboxListboxSysDateTimePick32SysMonthCal32.icl.exe.dllMsctls_Progress32msctls_trackbar32SysAnimate32msctls_updown32SysTabControl32SysTreeView32SysListView32-----@GUI_DRAGID@GUI_DROPID@GUI_DRAGFILEError text not found (please report)DEFINEUTF16)UTF)UCP)NO_AUTO_POSSESS)NO_START_OPT)LIMIT_MATCH=LIMIT_RECURSION=CR)LF)CRLF)ANY)ANYCRLF)BSR_ANYCRLF)BSR_UNICODE)\P{L}MARKACCEPTCOMMITFFAILPRUNESKIPTHEN\P{Xan}\b(?=\w)\p{Xps}\P{Xps}\P{Xwd}\p{L}\p{Xsp}\p{Xwd}\P{Xsp} \p{Xan}\b(?<=\w)\P{Lu}\h\P{Nd}alphalowerupperalnumasciiblankcntrldigitgraphprintpunctspacewordxdigit    \p{Nd}no error\ at end of pattern\c at end of patternunrecognized character follows \numbers out of order in {} quantifiernumber too big in {} quantifiermissing terminating ] for character classinvalid escape sequence in character classrange out of order in character classnothing to repeatoperand of unlimited repeat could match the empty stringinternal error: unexpected repeatunrecognized character after (? or (?-POSIX named classes are supported only within a classmissing )reference to non-existent subpatternerroffset passed as NULLunknown option bit(s) setmissing ) after commentparentheses nested too deeplyregular expression is too largefailed to get memoryunmatched parenthesesinternal error: code overflowunrecognized character after (?<lookbehind assertion is not fixed lengthmalformed number or name after (?(conditional group contains more than two branchesassertion expected after (?((?R or (?[+-]digits must be followed by )unknown POSIX class namePOSIX collating elements are not supportedthis version of PCRE is compiled without UTF supportspare errorcharacter value in \x{} or \o{} is too largeinvalid condition (?(0)\C not allowed in lookbehind assertionPCRE does not support \L, \l, \N{name}, \U, or \unumber after (?C is > 255closing ) for (?C expectedrecursive call could loop indefinitelyunrecognized character after (?Psyntax error in subpattern name (missing terminator)two named subpatterns have the same nameinvalid UTF-8 stringsupport for \P, \p, and \X has not been compiledmalformed \P or \p sequenceunknown property name after \P or \psubpattern name is too long (maximum 32 characters)too many named subpatterns (maximum 10000)repeated subpattern is too longoctal value is greater than \377 in 8-bit non-UTF-8 modeinternal error: overran compiling workspaceinternal error: previously-checked referenced subpattern not foundDEFINE group contains more than one branchrepeating a DEFINE group is not allowedinconsistent NEWLINE options\g is not followed by a braced, angle-bracketed, or quoted name/number or by a plain numbera numbered reference must not be zeroan argument is not allowed for (*ACCEPT), (*FAIL), or (*COMMIT)(*VERB) not recognized or malformednumber is too bigsubpattern name expecteddigit expected after (?+] is an invalid data character in JavaScript compatibility modedifferent names for subpatterns of the same number are not allowed(*MARK) must have an argumentthis version of PCRE is not compiled with Unicode property support\c must be followed by an ASCII character\k is not followed by a braced, angle-bracketed, or quoted nameinternal error: unknown opcode in find_fixedlength()\N is not supported in a classtoo many forward referencesdisallowed Unicode code point (>= 0xd800 && <= 0xdfff)invalid UTF-16 stringname is too long in (*MARK), (*PRUNE), (*SKIP), or (*THEN)character value in \u.... sequence is too largeinvalid UTF-32 stringsetting UTF is disabled by the applicationnon-hex character in \x{} (closing brace missing?)non-octal character in \o{} (closing brace missing?)missing opening brace after \oparentheses are too deeply nestedinvalid range in character classgroup name must start with a non-digit\P{Ll} \H\p{Lu}@`  @ \p{Ll}*+,-789:DEFGQRST^_`ajklm ( ) AnyArabicArmenianAvestanBalineseBamumBatakBengaliBopomofoBrahmiBrailleBugineseBuhidCCanadian_AboriginalCarianCcCfChakmaChamCherokeeCnCoCommonCopticCsCuneiformCypriotCyrillicDeseretDevanagariEgyptian_HieroglyphsEthiopicGeorgianGlagoliticGothicGreekGujaratiGurmukhiHanHangulHanunooHebrewHiraganaImperial_AramaicInheritedInscriptional_PahlaviInscriptional_ParthianJavaneseKaithiKannadaKatakanaKayah_LiKharoshthiKhmerLL&LaoLatinLepchaLimbuLinear_BLisuLlLmLoLtLuLycianLydianMMalayalamMandaicMcMeMeetei_MayekMeroitic_CursiveMeroitic_HieroglyphsMiaoMnMongolianMyanmarNNdNew_Tai_LueNkoNlNoOghamOl_ChikiOld_ItalicOld_PersianOld_South_ArabianOld_TurkicOriyaOsmanyaPPcPdPePfPhags_PaPhoenicianPiPoPsRejangRunicSSamaritanSaurashtraScSharadaShavianSinhalaSkSmSoSora_SompengSundaneseSyloti_NagriSyriacTagalogTagbanwaTai_LeTai_ThamTai_VietTakriTamilTeluguThaanaThaiTibetanTifinaghUgariticVaiXanXpsXspXucXwdYiZZlZpZs          / _ 0 M=%N+\19B]IQZ`bvB}_C  >   O%.29AHQPblQRSTD !E"#U  FG$'^/ 2 5VB`Sahbm p%z& '?(H)*WX+,@AI -&(Y2J=@cH.P/X[^adnKx01234Z[e56789:;L <  =>?p@@AACA@jKLjKhjKK A,K gBKBBB9"BM"B?(B+B0,B8-B.B-Bj5BM6B8B:B>B?B?B_B$_B@qBtBlvByByB/{B>{B|B~BB̄B`BdB:BBDBmB|XBBBBBBmBBBBGCCYC!C/CF\C0y y x .z T y nz r p{ hu { x } du $} lr b} Tx } 8x } Lr  d4v Dr 8r " q u ty |u ܕ p ^ L < 0 @ N b x Ҕ  * D T ^ l  z z z { { 0{ F{ Z{ z xz z  ̓ $ > x n b V T d r ~ J 6 (    Ғ Ē .} P} @} @ L ^ j r           4 @ L ` z Ԁ   " 6 R d v ~ ځ   * @ \ l | ʂ ڂ  " * R j z ƒ ԃ & D ` ~ ҄   * > V h z څ   . < T \ r ̆ ކ  ~ ~ ~ ~ ~ j~ ^~ L~ $~ ~ }   : ~ ę ҙ  * 6 H R ^ j z Κ ܚ  ( 8 J V f x ƛ   ́ ( { { { ~{ &'%M  ) } Η | f R <  Ж Ď Ԏ  " 8 H X j x ʏ   2 @ N ^ j v ֐   $ 0 < L Z d | ґ V H ,   ، Œ ^ N : &  z t f X J 8 *   ܊ Њ Ȋ v b V D 2 "  Ή ‰ t b R F 6 &   ܈ ̈ r \ D t b J 8 $  ڍ ƍ t 6 $  ڇ t f R < . ʋ h } } } p} } z z y | { { | | 2| D| p| | | | | \| | :z Zz Hz s  t o 49  . @ R j Θ  8 F ^ t WSOCK32.dllGetFileVersionInfoSizeWGetFileVersionInfoWVerQueryValueWVERSION.dlltimeGetTime2mciSendStringWwaveOutSetVolumeWINMM.dll{InitCommonControlsExSImageList_CreateoImageList_ReplaceIconTImageList_DestroymImageList_RemoverImageList_SetDragCursorImagePImageList_BeginDragVImageList_DragEnterWImageList_DragLeave^ImageList_EndDragXImageList_DragMoveCOMCTL32.dllWNetAddConnection2WIWNetUseConnectionW WNetCancelConnection2W$WNetGetConnectionWMPR.dllkInternetCloseHandleInternetOpenWInternetSetOptionWtInternetCrackUrlWZHttpQueryInfoWInternetQueryOptionWrInternetConnectWXHttpOpenRequestW^HttpSendRequestW5FtpOpenFileW2FtpGetFileSizeInternetOpenUrlWInternetReadFileInternetQueryDataAvailableWININET.dllGetProcessMemoryInfoPSAPI.DLLIcmpCreateFileIcmpSendEchoIcmpCloseHandleIPHLPAPI.DLL!LoadUserProfileWCreateEnvironmentBlock,UnloadUserProfileDestroyEnvironmentBlockUSERENV.dll?IsThemeActiveUxTheme.dllInterlockedIncrementInterlockedDecrementInitializeCriticalSectionAndSpinCountRaiseExceptionElstrcmpiWGetCurrentDirectoryWIsDebuggerPresentMSetCurrentDirectoryWGetFullPathNameWGetLastErrorRCloseHandleGetCurrentThreadGetCurrentProcessDuplicateHandleCreateThreadWaitForSingleObjectHeapAllocJGetProcessHeapHeapFreeSleepGetCurrentThreadIdgMultiByteToWideCharfMulDivGetVersionExWsGetSystemInfobFreeLibrary<LoadLibraryAEGetProcAddressXSetErrorModeGetModuleFileNameWWideCharToMultiByteHlstrcpyWNlstrlenWGetModuleHandleWQueryPerformanceCounterVirtualFreeExOpenProcessVirtualAllocEx.WriteProcessMemoryReadProcessMemoryCreateFileWgSetFilePointerExReadFile%WriteFileWFlushFileBuffersTerminateProcessCreateToolhelp32SnapshotProcess32FirstWProcess32NextWjSetFileTimeGetFileAttributesW9FindFirstFileW.FindCloseGetLongPathNameWDeleteFileWEFindNextFileWcMoveFileWuCopyFileWCreateDirectoryWRemoveDirectoryWSetSystemPowerStateQueryPerformanceFrequencyNFindResourceWALoadResourceTLockResourceSizeofResourceEnumResourceNamesWOutputDebugStringWGetTempPathWGetTempFileNameWDeviceIoControlGetLocalTimedCompareStringWDeleteCriticalSectionEnterCriticalSection9LeaveCriticalSectiondGetStdHandleCreatePipeInterlockedExchangeTerminateThread>LoadLibraryExWMFindResourceExWVirtualFree^FormatMessageWGetExitCodeProcessBGetPrivateProfileStringW+WritePrivateProfileStringW@GetPrivateProfileSectionW)WritePrivateProfileSectionW?GetPrivateProfileSectionNamesW$FileTimeToLocalFileTime%FileTimeToSystemTimeSystemTimeToFileTimeFLocalFileTimeToFileTimeGetDriveTypeWGetDiskFreeSpaceExWGetDiskFreeSpaceWGetVolumeInformationWSetVolumeLabelWCreateHardLinkWaSetFileAttributesWaGetShortPathNameWCreateEventWYSetEventGetEnvironmentVariableWWSetEnvironmentVariableWGlobalLockGlobalUnlockGlobalAllocGetFileSizeGlobalFreeGlobalMemoryStatusEx6BeeppGetSystemDirectoryWGetComputerNameWGetWindowsDirectoryWGetCurrentProcessIdNGetProcessIoCountersCreateProcessW}SetPriorityClass?LoadLibraryWVirtualAllocKERNEL32.dllDestroyIconMessageBoxA-GetForegroundWindow|GetSysColorBrushLoadCursorWLoadIconWMRegisterClassExWnCreateWindowExWShowWindowSetTimercRegisterWindowMessageWkCreatePopupMenuKillTimer7PostQuitMessageSetFocusMoveWindowDefWindowProcWMessageBoxWGetUserObjectSecurity-OpenWindowStationWhGetProcessWindowStationSetProcessWindowStation(OpenDesktopWNCloseWindowStationJCloseDesktopSetUserObjectSecurityGetWindowRect6PostMessageWMapVirtualKeyW|SendMessageW&GetDlgCtrlIDdGetParentGetClassNameW;CharUpperBuffWEnumChildWindows{SendMessageTimeoutWmScreenToClientGetWindowTextW,GetFocus AttachThreadInputGetWindowThreadProcessIdGetWindowLongWInvalidateRectEnableWindowIsWindowVisibleIsWindowEnabledIsWindow#GetDesktopWindowEnumWindowsDestroyWindowKGetMenuGetClientRectBeginPaintEndPaint!GetDCeReleaseDCUCopyRectSetWindowTextW'GetDlgItemsSendDlgItemMessageWEndDialog MessageBeepDialogBoxParamWLoadStringW!VkKeyScanW=GetKeyStateBGetKeyboardStateSetKeyboardStateGetAsyncKeyStatevSendInput0keybd_eventSystemParametersInfoWFindWindowWIsIconicSetForegroundWindowTGetMenuItemInfoWSetMenuItemInfoWQGetMenuItemCountRGetMenuItemID@CheckMenuRadioItemDeleteMenu GetCursorPosTrackPopupMenuExIsMenuInsertMenuItemWSetMenuDefaultItemEnumThreadWindowsFindWindowExWSetActiveWindowExitWindowsEx1mouse_eventfCreateIconFromResourceExLoadImageWMonitorFromRect-CharLowerBuffWUnregisterHotKey3PeekMessageWTranslateMessageDispatchMessageWLockWindowUpdate]GetMessageWBlockInput&OpenClipboardIsClipboardFormatAvailableGetClipboardDataICloseClipboardVCountClipboardFormatsEmptyClipboardSetClipboardDataSetRectAdjustWindowRectExTCopyImageSetWindowPosGetCursorInfoVRegisterHotKeyGClientToScreenAGetKeyboardLayoutNameWIsCharAlphaWIsCharAlphaNumericWIsCharLowerWIsCharUpperWXGetMenuStringWzGetSubMenu GetCaretPosIsZoomedMonitorFromPoint_GetMonitorInfoWSetWindowLongWSetLayeredWindowAttributesFlashWindowGetClassLongWTranslateAcceleratorWIsDialogMessageW{GetSysColorInflateRectDrawFocusRectDrawTextWFrameRectDrawFrameControlFillRect@PtInRectDestroyAcceleratorTableXCreateAcceleratorTableWSetCursorGetWindowDC~GetSystemMetricsDrawMenuBarGetActiveWindow1CharNextW3wsprintfWJRedrawWindowDestroyMenuSetMenuGetWindowTextLengthWjCreateMenuIsDlgButtonCheckedDefDlgProcWCallWindowProcWdReleaseCaptureSetCaptureUSER32.dllGetDeviceCapsDeleteObjectGetTextExtentPoint32W/CreateCompatibleBitmap0CreateCompatibleDCwSelectObjectStretchBltGetDIBitsDeleteDCGetPixel2CreateDCW GetStockObject$GetTextFaceWACreateFontWSetTextColorTCreateSolidBrushKCreatePen~SetBkColorjRoundRectSetBkModeGetObjectWSetViewportOrgEx_RectangleBeginPathPPolyDrawEllipse:MoveToExAngleArc6LineToCloseFigureSetPixelEndPathStrokePathStrokeAndFillPath2ExtCreatePenGDI32.dll GetOpenFileNameWGetSaveFileNameWCOMDLG32.dllaRegOpenKeyExW0RegCloseKeynRegQueryValueExW4RegConnectRegistryWwInitializeSecurityDescriptorvInitializeAclAdjustTokenPrivilegesOpenThreadTokenOpenProcessTokenLookupPrivilegeValueWDuplicateTokenEx|CreateProcessAsUserW}CreateProcessWithLogonW6GetLengthSidvCopySidLogonUserW AllocateAndInitializeSidQCheckTokenMembership FreeSidZGetTokenInformationHGetSecurityDescriptorDacl$GetAclInformation#GetAceAddAceSetSecurityDescriptorDacl}InitiateSystemShutdownExWeGetUserNameW9RegCreateKeyExW~RegSetValueExWORegEnumKeyExWDRegDeleteKeyWHRegDeleteValueWRRegEnumValueWADVAPI32.dll"ShellExecuteW.Shell_NotifyIconW*ExtractIconExWSHFileOperationWSHGetFolderPathWSHGetSpecialFolderLocationSHGetDesktopFolderSHCreateShellItem{SHBrowseForFolderWSHGetPathFromIDListWSHEmptyRecycleBinWDragQueryFileW!ShellExecuteExW DragQueryPointDragFinishSHELL32.dllgCoTaskMemAllochCoTaskMemFreeCLSIDFromStringKProgIDFromCLSIDCLSIDFromProgIDGOleSetMenuDescriptorMkParseDisplayNameFOleSetContainedObjectCoCreateInstanceIIDFromStringyStringFromGUID2CreateStreamOnHGlobal>CoInitializelCoUninitializeGetRunningObjectTable-CoGetInstanceFromFile5CoGetObject@CoInitializeSecurityCoCreateInstanceExcCoSetProxyBlanketole32.dllOLEAUT32.dllExitProcessGetModuleHandleExWExitThreadyGetSystemTimeAsFileTimeResumeThreadGetCommandLineWIsProcessorFeaturePresentHeapSize IsValidCodePagehGetACP7GetOEMCPrGetCPInfosSetLastErrorUnhandledExceptionFilterSetUnhandledExceptionFilterTlsAllocTlsGetValueTlsSetValueTlsFreecGetStartupInfoWiGetStringTypeWSetStdHandleGetFileTypeGetConsoleCPGetConsoleModeRtlUnwindReadConsoleWfSetFilePointerGetTimeZoneInformationGetDateFormatWGetTimeFormatW-LCMapStringWGetEnvironmentStringsWaFreeEnvironmentStringsWHeapReAlloc$WriteConsoleWSSetEndOfFileVSetEnvironmentVariableAAA`H.?AVbad_alloc@std@@`H.?AVexception@std@@?powlogatanacosasintancossinsqrt"L"L`H.?AVtype_info@@K`y!@~ڣ @ڣ AϢ[@~QQ^ _j21~ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ        ! 5A CPR S WY l m pr   )    CHHHHHHHHHHHHHHHH HHHHH H$H(H,H0H4Hc{#Tw=:zc%C1jm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ホCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-PK4RKLNK,NKNK@BCEGHIJLKLNMMONOMMNLKLJIHGEDB@>=;97520.+)'%"   "$'*-0368;>BCFHKMOQSUXZZ[^_^_a`baaaaab`a_^_^[ZZWUSQOMKHFCB>;8630-*'&"  !$(+/259<@CHJMPSVY\`acegiknnqqrstvuwvvvvvwuvtsrqqnnkigeca`]YVSPMJGC@<972/+($!   #&*.26:>BFJNRWY_adgjmrswz|~~|xwspojgda_ZVRNJFB>:620*&#   #),049?BGKPVY]cfjorwy~~ywrnjfb_YVPMGB>940,)#  "'+05<ADKOT[^chmsv|  ()4$7&7(=,"E3%H6)H6)I7+J:.J:.J9.I9.I9.I9.I9-I9-H8,G5(G4'B0#=*6(2#1!*$!   |xrmjc`[TOKDA<50+'"   %)/49?EKQX\bimty~ *9+"@0&N;0P?3w\JւdQۓoVw[|a깋jmpȚyנ|ՠ|ԟ|Ԡ~եӡ~ҟ|ў|ϝ{Μz͛x͜z̛{ɖsǑmƒmkh_yYrUhLaBuTDJRW]dlrv~ (8*"G7+VC5u\HՍnXݨhyʟޭ㱏Ⳓ᱑ޭ٧ؤ֡~Ԡ{Ӟ|ϚuϘtΖs̗s˕rʓnǏhŌdċdÊba_cgedcadedfgghaf]}ZtOdGY;nL4S:(B,3!% ~xrld_WRJD>82.'!  "(.4<AHOV^dlqx 2%H8,[G9cPע}e㺒vУ岐紒嵓䳑ⱎ߭ݫ٦ڥأ~Әpΐf̌`ʉ[ɇZDžX~O|MzLxJwHvGtEtCsBq@o?n=k;j:i9h8g7f6j;k>i5/&"  %,3;CLV]fox:-#eN?ʓs\۹uݭ7괎谊筆竃䩀~}ߣ}zߟxܠxܟuۜuٜrכrԙpӖmӖm͋^ɅVʄUɁSQN|N|LzJvHvEuEsCqAn>n=k:k:j8h5e5e4b3b1_._.]-Z*Z)Y)X&Y'V%U&V%V$U"S!S!T"R!R!R"S!S!Z*_1f9mBuK|RW}UlIzS8V;'7% xqh^ULE;3,%  ")09BKT_gp{\G8ƉjUټv௎﷐밊鯇鮅謄笂䩀䧀~ߤ}ޡ{ߟxݞxܟvۜsٜsכrԙnӖnӖm͊]ɅVʂSǂR~P}M}MzIyGuEuEtBr@o>o>l:j8j6g6g3d1d0b/_/_,\,Z)Y'Z(W%W$U%T$S#T"R!Q RRQOQOOPR S"U$X']-d6l>sH{PW}VmJzS9S8&-{rg_TKB91)"  %-5>HR]eq{E3)uZGѧfاﴍ밇诇譅笃櫀㧀~}ޡ{ޟx۟xڝv۝tٜqכq֙n՘nԖm͉\˄UʃTȀPN~N{L{JwHvFsDsAq@n=n=m9k9i7f5f3d0a0a/^,^,\*Y'Y'Y&W%T$U#T Q RQPNPMNNLNOPPS!U"U$W&Y)^.d6k>sH}SY{UgEnJ2A- |pf\RH>7-%   (2:EOXdmy XB2ÊhQŖv寋ﶏﲋ뱊鮈鮆諃笃䩁~}|ߤ{ߢ{ޟy۟x۞tڛtךr՚q՗oӗlӖlΉ[ɄUʃTȁP}N~N|JzIvFtDtBsBo>o4*"  #,6ALYeq{\D2ßwZҟy﵎ﳌ뮈讆諄竁檁~~}|ޡyݟw۞wڝtٛrؚp֙qՙm֘n՗l͇VͅV˃TˁPNL}KzIyFvDvDtBr>p=n:l9i5g5e3c/`-_-]*[(Z&X$V$T!S!SPPOMKLIHJGFGEEGGJKMMPPR T$X&Z)\+^._0b2f8l?tGU\}WbET;( }peYLA6,#  $-7CO[hv8(jOҝv﵎ﳌ믈鯆鮄諄竁~}|{ߣ{xݡxޠwݝuܞsڝrٙpؚoטmЉXЈWφǗR˂PʁN}L}J{HyFwDvBt@r>pp-|[z﵍쮆뭅ꬃ骁詀~{{zxߞvޞs۝sۚpښpؘm҈XцWЄU΃QˀPˀN}L}J{HyFvDvBt@rr=p;n9k7k5g3g1e/c-`)`)^'\%Y#W!WTRSQONMKIHF D A ? >@A @ A DEEHHKMNPR V!X$Y)],`.c3d5i8k=n>pBvIRNJ`Y\B#obRD8,"   *6CRao5%xVޠu~~﯄쮅髃驀詀~zzyvߞtޞtܝqٛoٙoהhшWχWυŨR̀PɀL~J{HyFwDuBu@r?p;n9l7l5i3g1g/e-c,`*`'^%\#Z!WWURROMMLIIHF C C A@>>> A A B EFFIKMOQRT"V$Y'],`.c3e6j:k:o>qDuGzN‡Yċ`qOC1$oaQC6*   '3@N]oS;*bx{}쮅뭃詀詀|zzywߞuޞr۝rۚoښoؔh҈WчUЅT΃PˀNˀM~K|IzGxEuCuAs=q?A @ C CFFIKMMQST"X$Y'],`/b1g6j7msDuGyLVȋb~XgJ6o_N@3'  #.<LZl{cF1ʐgwy{}}﯄쮅髃驀詀}}zzywߞuޞrܝrٛpٙnהhшWχVυT̃P̀OɀM~K|IzGxEuCuAs=q@@@??@ C CDGHKKOQRW#W$Y'\*a/c3f4j7l=q?rCvIzLSNJ__[? {l\K</#  *6EUfx\?՘kuwy{}}﯄쮅髃驀詀}}zzywߞuޞrܝrٛpٙnדfшWχVυT̃P̀OɀM~K|IzGxEuCuAs=q==?@@AA? @ C D DHHKKOPTV#X$Y']*b/e2f4k:m=?>AAA@@ A D DGIKMOPRV#W&\'`,a/d1i7l:o<>==@?ABB@A D DGHJMNPTU#Z&\)`*c/e2h7m;n>sBuFxI}PSÇ[njbcG ~lXG7*  "/>NbsaC-Аcorttwy{}﯁쮅뭃詀詀}}zzywߞuޞr۝rۚoښoՐbӈWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q>=?>@@BBA B D D HJJNNRSX$[%^'_,d/h4i7n=p?uExIyK~OT†YǍabFuaP>/#  '6FVhS:'ɋ]lprttwy{}}쮅髃驀詀}}zzywߞuޞrܝrٛpٙn֑cшWχVυT̃P̀OɀM~K|IzGxEuCuAs=q=?>A@BC B B EEHHLLNSV!Y$\%](`.c0h4l:n???A@CD D C D GGKKNOTW Z$]'^*c/f1j8n:q@rAwHyI|ORWNj_]ZA/r]L:+  !.?O h^>hklprttwx|쮅뭃詀詀}}zzywߞuޞr۝rۚpښnԎ^ӈWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q>====<>==@?AAD EC C FFJKLPSTX Y#^)_*b.f3k7m=rAtEyGzM~QTYɍayU5%xdQ>/"  %1AS^A)я^iklprttvz{쮅髃驀詀}}zzywߞuޞrܝrٛpٙnԍ^шWχVυT̃P̀OɀM~K|IzGxEuCuAs=q=?>>AAD E D FEHHLMPUW X![%`*a,f2i6k:p>rBwFzK~OSV‡\ȍacG |iTB2$   %5D  dkGhiklprtvxz{쮅髃驀詀}}zzywߞuޞrܝrٛpٙnԍ^шWχVυT̃P̀OɀM~K|IzGxEuCuAs=q??>?BAD F F D FIKKPSTX!Y#^(a+d.g2i6n:p>uBxHzKOUXƋ^]^C0kWF4&    &5FdC+א_giklprsvxz{쮅뭃詀詀}}zzywߞuޞr۝rۚpښnԌ\ӈWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q?>@?@BBE G G GFJJORTUW"\$]'b-e1g5m9p=s?uFzK|MSV‰\ʏbhI n[H5'    '6%UkFfgiklpquuxz{쮅髃驀詀}}zzywߞuޞrܝrٛpٙnӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q@A@ACF G GFGKKPQUW Y"]%_)b-e1i5l9q?sBxHzK~RVZŋ^]dG1oZG6)    '5V9%wҌ[egiklosuuxz{쮅髃驀詀}}zzywߞuޞrܝrٛpٙnӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q=?@A@AD D F G HGHLOPTTY"\#_(b,d0i4j6p=sAuD{J~ORVˆZȏafHyZG6'    &6sL1cegijnqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۚpښnӊZӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?@ABABE D G IIHJNPQSVY#\%a*d.h2i6n9p?uDyF{KQVÈZNj^WQ9(YF5&     %,BmGdegijnqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٛpٙnӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=>?@BCCE F F JHIMOQRWY!Z#_(b,d0g4m7p=tBxDyJ}OR…XĊ\Ƌ_qP7WD3% #"  #L3 VʇUceghlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٛpٗlӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@ABCD E D G IJIKNOQTXY#\$_*d.h2k6m9q>vDyG}MPTĉYʏagH `@2# +( [<&eِ]cefjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۛpٗjӊZӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@ABCDE D G G JKLLPRSWX \#^'c,f/h4k7q>s@vF|KPTÆYNj^|UI5%v=-!   2!8#  c@)x_cdhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٛpؖiӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?@ADCE E F HKKMMQRTX [#]'b)c/h1j7nuDyI}LPUŊ\Z[@,7*    <&X9%C,  R4bbfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٛpؖiӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABBD E F F IKMLMOSSWZ \%a'd-g/i5n:r>uAyG}LOUĉZŋ]gG01&  # H/dA)I/ <'&yMadfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۛpؖiӊZӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDE F G G KMLNNRTUX[$`&a+d/i2m8o>=?@?ABCDE F G GILMNNRRTYZ#]&a(c,h2j6o9q?vDyH}KRąWȌ\uO<+?   2#2"b@)zP4^<]=( [;%F_ccfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڛp֔fӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDE F G G JJMNOOSUXY"^%_(c*e0j3n9p>uByE}KPĆTʋZVP9%P 4#O6$:(#d@T6%\;%P`deehjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۛpؔfӊZӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDCF G G J KKNOORSWX!]$^'a)d/i3m6o:t@xE|HM…TȊZNj\_C,c M5"X<'a>jDtKfB+[:%cbdeehjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڛp֔fӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC D G G JKKNOPPRWY \#]&b(e.g0l6o:q=uCyF}KQljYʎ^cF/n B,pM1`C+O7$iCxM`?b?obdeehjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڛpבbӊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC D G G JKLLOOPRVW[ \%_'d+f1k3m7r=vBzE|KQƈW͏^eG/~ !dD*xQ3Z>)yN~PȃTڏZbeeehjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۛp׏`ӊZӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E E H JKLLOQPSTXY]$`(c*e.j3l6q>=?@?ABCDC E F F JKLMMQPSUVZ[#^'b)d.i2k6p9t?xB|H~LÄSˋ[XzU7tN/c=׎Y+\cecfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڛpՏ`ԊYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F HKLMMORRUUZZ!_&`(e-h1j5o:s>wA{GKƒSɋZƉZvK5i@g@d?ݑ[;]decfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۛpՎ_ӊ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I KLLOORRUUYZ ]%a)d,g.i2n9r=vAxF}J„RɊYȋ[ǵ{NClC\G^eecfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڛpԌ]ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I I LMMPPSUUW[!^$_&c+f-h3m6q:u>wC}JÁOɊXɌ[ܸ|MX_Y^eecfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڛpԌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JJMMPPSUVXY]"^'a*d,g0k6p;t=xC{GNȉWʌ[~Pf`d_gecfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞr۝rۛpԌ\ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNPRSSTXZ ]!_&b(e-g1l5n8s>=?@?ABCDC E F F I JKKNPPSSTXX\ ]&`)c+h0j4o8q;vAyE~KLJUʋZ˓gˆ\_Zbgccfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrڙnԌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLPPSUVVYZ^%a(d*g/i3n7r:t@xE}JƆTˌ[ˎ^†T_*[cfbcfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞrܝrژlԌ\ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNPRRUVVYZ^$_&b+e-j1l6q:u=wB|HŃRʋZɋZƒQ,_8[egadfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrژlԌ\ԋYщXχV΅T̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLPPSUVVY[\"`'c)f.h2m4o8t>vCzGÄQˌZɋZ‚O;^E\ffadfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞrܝrژlԌ\ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNRRUUXX[[#`%c(f-i1k5p7r=wBzFāNʋYʌ[ÄPJ^V]gf`dfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrژlԌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOPSUUYX[ [!^&a)e+g/l4n8q;uAyDÀMʋYɋYNX__^ge`dfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٔgԌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLNPSUUYX[ [!_%b'c,h0l2o5r;v@yCKȉXɋZNl_ X{_ieadfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞrܝrٕhԌ\ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNPRRUUWZ[["]#`(d*f/k3o6p9u?xC~KɊWʋZMt^W_hb`dfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٕhԌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLNPSUUXZ[["]#a&d+e-j2l4q8s=wB}IȈUʋYɊXńQ^*Xcib`dfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrٕhԌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOQSUUXZZ["]$a%b)e.j2m5o7t>xA{GdžTʋYLJTÁM^0Ydhabdfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞrܝrٓeԌ\ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQSUUXX\ ["]$a%c*f,j1m3p6t=v@{FdžSˍ[ʊXÁM3^BZeh``dfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrבbӌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOOSUUXX\ ]"]$_$a)d+i0k4n6s=uAyDƅRʌZljWÁM:\I[gg^`dfhjlmqsuuxz{쮅髃驀詀}}zzywߞuޞrܝrؑbӌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOOSUUXX\ ] ]"`$a)d,i.l3o7s=?>@A@BCDC E F F I JKKNNQQUUXXZ]"]"`$a'd,i/l1m5r;v>xBŃNʌ[ɊX€LV] Uq\ie^`dfhjlmqsuuxz{žâ쮅髃驀詀}}zzywߞuޞrܝrؑbӌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOOQUUXX[]"]"`$a'e,g/j0n6p9t?xAăNˌ[ʊY€Lh]U^jb^`dfhjlmqsuuxz{ž쮅髃驀詀}}zzywߞuޞrܝr֏`Ӌ\ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORSVXX[]"_"_$b'e,h/k0n4p:u>w@€KʌZʋYÂNq]U_ka^bdfhjlmqsuuxz{쮅뭃詀詀}}zzywߞuޞrܝr֎^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTVXX[]"_$`$`(c*h-k0l5q:s>=?@?ABCDC E F F I JKLLOORTVXX[[ _$`$`(d+f.i1m3o9r=v@}HɊXˍ[ɇS€L\9Wei^^`dfhjlmqsuuxz{ß쮅髃驀詀}}zzywߞuޞrܝr֎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTXX[[ _$`$`&d)g.j1m3p9r=v?|FȉWˌ[ɉUÁM+[@Yhh]^bdfhjlmqsuuxz{à쮅뭃詀詀}}zzywߞuޞsܜq֎^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTXX[[ _$_$b&d)g.j1m4p7s;u@{DȈV̎]ʊVÁL7\NYih\_`dfhjlmqsuuxz{à쮅髃驀詀}}zzywߞuޞsܚo֎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTXX[[ _$a$b&b)g.j/m2p8syBLJT̏^ʋXÁMA^Y[[kf\_`dfhjlmqsuuxz{ţ쮅髃驀詀}}zzywߞuޞsۚn֎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTXX[[!_"a%`&b*g,j0k3n6q;v=yBdžS̏_ʊW€KP\Sv\kc\^bdfhjlmqsuuxz{Ť쮅뭃詀詀}}zzywߞuޞsۚn֎^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTXX[[!]"a%b'b(g-j.k1o7r;t=xAƅQ̐_ˌXÁKZ\S^nb\_`dfhjlmqsuuxz{ţ쮅髃驀詀}}zzywߞuޞsۚn֎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTXX[[!_$a$a'd(e+h/l1o7r;t>xAĂP̏_ʌY€Jg\%T`n`\_`dfhjlmqsuuxz{Ģ쮅髃驀詀}}zzywߞuޞsۙm֎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTXX[[!_"a%a'd(e,i/j1o6r:t=?>@A@BCDC E F F I JKKNNQQTTXX[[!]#a%b'b)f*i-j2n4p8u=xAÀK̎^̍[ɈSŃLZ7Vfk\\_`dfhjlmqsuuxz{Ƥ쮅髃驀詀}}zzywߞuޞsٗj׎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTVY[[!]#a%a'd)e*i.k0l5q9s;w@Iˍ\̏]ʊVĂM Z?WijZ]_`dfhjlmqsuuxz{Ƥ쮅髃驀詀}}zzywߞuޞsٗj׎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWY[[!^#_%b'd)f*g.k0l5q9t=?>@A@BCDC E F F I JKKNNQQTTWY[[!^#`%b'd)e*h.i1m3o8r:v@{EʋY͑`ʊVāL:]UbZngY]_`dfhjlmqsuuxz{ßɪ쮅髃驀詀}}zzywߞuޞsؔf׎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWY[[^#`%b'c(g,g-i1m3p8r;w>zCȊW͒aʉUāLF[Q[ocY]_`dfhjlmqsuuxz{Þɪ쮅髃驀詀}}zzywߞuޞsؓe׎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWY[[^#`#b'd)e*h.i1m4p6r9w?zBȉVΓdʋXāLO[Q]qaY]^bdfhjlmqsuuxz{Ÿɪ쮅뭃詀詀}}zzywߞuޞsؓe׎^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWW[[^#`#b'd)f+h,i/m4p7s9w=yBȈTΓdˌYāJZZ#Rap_Y]_`dfhjlmqsuuxz{Ģȩ쮅髃驀詀}}zzywߞuޞsؓe׎^Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWW[[ ^!`#b'd)f+g,j0k2n7q:u>=?@?ABCDC E F F I JKLLOORTTWW[[ ^"`#b'd)e+i,i0k3o5q8v=?>@A@BCDC E F F I JKKNNQQTTWW[[ ^"`$`%d)g+i,i0k3o6q8v>y@ăMΓd͏]ȈRŃMZ?TjlVY]_`dfhjlmqsuuxz{ƤǦ쮅髃驀詀}}zzywߞuޞsבaՏ_Ӌ[ԋYщXχV΅T̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWW[[ ^"`"`&d)g+i,i0k1o4r9t=x?ÀI͑`͐_ʈSłM&RLXojWY]^bdfhjlmqsuuxz{ǦȦ쮅뭃詀詀}}zzywߞuޞsבa׎^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWWY\ ^"`"`&d)e+g-j.k2o5p7u;x?~H͐_ΒaʊSłL.Y NjXpgWY]_`dfhjlmqsuuxz{ȨǦ쮅髃驀詀}}zzywߞuޞsבaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZ\ ^"`"`&d)f+h-j.l1m5p6u>=?@?ABCDC E F F I JKLLOORTTWWZ\ ^"`$`&b'f+h+j.l3m5q6s:w>{Bˎ\ΔdɉTŁKBYM[taWY]^bdfhjlmqsuuxz{ɩȦ쮅뭃詀詀}}zzywߟuݛoאa׏^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWWZZ^"`"`&b(f)h+j/l1m5q6s;x?zBʌZЖȟYŁKLY Pbr^WY]_`dfhjlmqsuuxz{˫Ǧ쮅髃驀詀}}zzywߟuݛoאaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZ\ ^"`"`$b(f*h+j/l2n3o7t9x=zAɊWϕǧXāKVY*Ocq[WY]_`dfhjlmqsuuxz{˫ƥ쮅髃驀詀}}zzywߟuݛoאaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZ\ ^"`"`$b(f*h,j-l1l2p5t:w>y@ȉUИjˌY̋WcdžQY0QipXWY]^bdfhjlmqsuuxz{˫Ƥ쮅뭃詀詀}}zzywߟuݚnאa׏^Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWWZZ^"`"`$b(f*h,j-l1l2n5s:u>=?@?ABCDC E F F I JKLLOORTTWWZZ\ `#`$c(d*h*j.l1l2n6s8v;x>ńNЗh͎]ʉQŃLY߉LGUqkSXY]_`dfhjlmqsuuxz{žͱƤ쮅髃驀詀}}zzywߟuܘjא`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZZ^"`"`%b&f*h,j-l1l3n4q9vĀJϓeΑ`ɈQŃL#X ߈LlVqhTXY]^bdfhjlmqsuuxz{ŸαƤ쮅뭃詀詀}}zzywߟuܘlא`׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWWZZ^"`"`%c&d*h*j.l1n3n4q9vHϓdϒaˇPŁK(X߈LyYxeTXY]_`dfhjlmqsuuxz{žͱƤ쮅髃驀詀}}zzywߟuܘkא`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZZ^"`"`%c&d*h*j.l1n3n4r7t:w>}D͒bЖgˉTŁK3X߈KYv`TXY]_`dfhjlmqsuuxz{ţͱƤ쮅髃驀詀}}zzywߟuږiא`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZZ\ `#`%c&e*f*h,l/n3n5r8u;x=z?̐^ЕfʈRŁJ=XߊObu]TXY]^bdfhjlmqsuuxz{ƤαƤ쮅뭃詀詀}}zzywߟuڕgא`׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWWZZ\!`#`%c'd(h+j,l0n1n3r8u;x>z@̏]ӛm͍WŁJBX(ߊNbtYTXY]_`dfhjlmqsuuxz{Ƥͱƣ쮅髃驀詀}}zzywߟuڔgא`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZZ]!^!a%c'e)f+h,l0n2n3r6s9x>=?@?ABCDC E F F I JKLLOORTTWWZZ\!`#`%c'e)g+i,j0n2n3p7t:v=y?ʊWҚm͌XŁJTV6PlqQTXY]^bdfhjlmqsuuxz{ɨ̭Þ쮅뭃詀詀}}zzywߟu۔gא`׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKKNNQQTTWWZZ\!`#`%c'e)g+i,k0l2n3r7s:w;y>DžOҚmΎZʇNvƄMXކIGTtlQTXY]_`dfhjlmqsuuxz{ɨ̭Þ쮅髃驀詀}}zzywߟuٓdؐ`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZZ\!`#`%c'e)g)i-k0m2o4p7t8wDŽNқm͏\ɅMƂKW ކJlTshRTXY]_`dfhjlmqsuuxz{ɨ̭Þ쮅髃驀詀}}zzywߟuٓcؐ`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLOORTTWWZZ]!^!a%c'e)g)i-k0m2o2p5t9włJљjϓaɆOƂKWކI}W{dRTXY]^bdfhjlmqsuuxz{ʪ̭Þ쮅뭃詀詀}}zzywߟuٓcא`׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKLMOQQTTWWZZ]!_!_#c'e)g)i+k.m2n2r6t7w>=?@?ABCDC E F F I JKLKOORTTWWZZ]!_!_#c'e)g)i+k/m2o2p6r7u;x=}CЕgҘjʈRƁJ,WވKbx\RTXY]_`dfhjlmqsuuxz{˭̭Þ쮅髃驀詀}}zzywޞtٓcؐ`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLIOORTTWWZZ]!_!_$a%e)g)i+k/m2m2q6r8v9wΓdқlʇRŁI8W#އLexVRTXY]^bdfhjlmqsuuxz{̭̭Þ쮅뭃詀詀}}zzywޝqٓcא`׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKLIKPRTTWWZZ]!_!_$a&e'g*i+k/m2m2q6t8v9w=z>ΒaӝpˉTƁI;V'ߊNmuRRTXY]_`dfhjlmqsuuxz{ͯ˭ß쮅髃驀詀}}zzywޝqْcؑ`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLKINRTTWWZZ]!_!_$b&c(g*i+k/m0m2q6r8v9x=y=̎[ӝo͋VƁIGߋR2ߊOpsOSTXY]_`dfhjlmqsuuxz{ΰˬ쮅髃驀詀}}zzywޝqْcؑ`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLLIKQTTWWZZ]!_!_$b&d(e(i,k/m1m3q6s8t:x;y>ˌYԟtΌWȄLNV݅FJߌRumOSTXY]^bdfhjlmqsuuxz{βʫ쮅뭃詀詀}}zzywޝqٓcא`׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=?>@A@BCDC E F F I JKLMIJPTTWWZZ]!_!_$b&d(f(g,k/m1m1q6s8t:x;y>ɇRԟs͍ẌQcɅNV ݅FhߌSvhOSTXY]_`dfhjlmqsuuxz{žΰʫ쮅髃驀詀}}zzywܛoْcؑ`Տ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q>=?@?ABCDC E F F I JKLMIILSUWWZZ]!_!_$b&d(f(g*k/m1m1q4s8t:x>=?@?ABCDC E F F I JKLMIIJPUWWZZ]!_!_$b&d(f(h*i-m1m1q5s8u:v=?>@A@BCDC E F F I JKKNJIJLTWWZZ]!_!_$b&d(f(h*j.k/m1q5s8u:v=?@?ABCDC E F F I JKLMLIKKPWWZZ]!_!_$b&d(f(h*j.l0m1q5s8u:w=?@?ABCDC E F F I JKLMMHILMVXZZ]!_!_$b&d(f(h*j.l0n2o5s8t:wy>ϔdҘïPƂI-LmT#އKgqOPSTXY]^bdfhjlmqsuuxz{ȧαʫ쮅뭃詀詀}}zzywۗjڒbבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q?>@A@BCDC E F F I JKKNNHILLTXZZ]!_!_$b&d(f(h*j.l0l0p3s6v:v:y>z>Α_ӛkˉQǁH4 "aT&ވLkmLQSTXY]_`dfhjlmqsuuxz{ȧΰʫ쮅髃驀詀}}zzywۗiڒbؑaՏ_Ӌ[ԋYщXχV΅T̃P̀OɀM~K|IzGxEuCuAs=q88668879:<>=?@?ABCDC E F F I JKLLOGJJKOWZZ]!_!_$b&d(f(h*j.l0l0p4s7v:v:y878887998<>?>@A@BCDC E F F I JKKNOGHKLMVZZ]!_!_$b&d(f(h*j.l0l0p4q7t8xˌWӜoΊTǁHCҘض T܃D^މOpaMQSTXY]_`dfhjlmqsuuxz{ʪΰȨ쮅髃驀詀}}zzywۗiڒbؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q886688798<>=?@?ABCDC E F F I JKLLOHHIJLQZZ]!_!_$b&d(f(h*j.l0l0p4q7u9v:y=z>ɈQӜn͋TɃIYǂJ GבS ݃DߋQs\MQSTXY]_`dfhjlmqsuuxz{ˬΰȨ쮅髃驀詀}}zzywڕgڒbؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q=?@?ABCDC E F F I JKLLOIHJJMOY[]!_!_$b&d(f(h*j.l0l0p4q7u9w;y@A@BCDC E F F I JKKNOJGJKKMU[]!_!_$b&d(f(h*j.l0l0p4q7u9w;y~BДcєbˇMǂH AԒR݅Gbk߈KMQSTXY]^bdfhjlmqsuuxz{ΰαȩ쮅뭃詀詀}}zzyvڔfړbבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q@A@BCDC E F F I JKKNONFGHKKNU]!_!_$b&d(f(h*j.l0l0p4q7u9w;y=y>|@ГbҕcˇNǂI(ʤ cQ܆Hfd߈JMQSTXY]_`dfhjlmqsuuxz{ΰΰȨ쮅髃驀詀}}zzyߟtڔeړbؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q?@?ABCDC E F F I JKLLOOFHHKJLR]!_!_$b&d(f(h*j.l0l0p4q7u9w;y={?|?ϑ^җg͈PǂH,S +Q܃FA݆Hha߈KMQSTXY]_`dfhjlmqsuuxz{žΰΰȨ쮅髃驀詀}}zzyߞsڔeړbؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q?@?ABCDC E F F I JKLLOPEHIIJMO[ _"_$b&d(f(h*j.l0l0p4q7u9w;y={?|@͎YҖf̈PǂH3ɷҳQ܁CV݇Il\߈KMQSTXY]^bdfhjlmqsuuxz{àΰαǧ쮅뭃詀詀}}zzyߞtڔeړbבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q?@A@BCDC E F F I JKKNOPEFGJKKNX_"_$b&d(f(h*j.l0l0p4q7u9w;y={?|@͌WԚlΊSȁH;h (}ߋP ܁C}ވLlX߈KMQSTXY]_`dfhjlmqsuuxz{àΰΰǦ쮅髃驀詀}}zzyߞsڔeړbؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q9986688798:8<?@?ABCDC E F F I JKLLOPFDEHIIJMV `$b&d(f(h*j.l0l0p4q7u9w;y={>|AȂIҕdё]ˆLȃJ Ľ!JߊO܃D[eކHLMQSTXY]_`dfhjlmqsuuxz{ǦΰΰǦ쮅髃驀詀}}zzyޝpړeړbؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q@?ABCDC E F F I JKLLOPHDFFIJKLS`$b&d(f(h*j.l0l0p4q7u9w;y={>|BǀCҔaҔ`͈NƄKg7 N܃E`_ކILMQSTXY]^bdfhjlmqsuuxz{ɨΰαǦ쮅뭃詀詀}}zzyޝpڔeړbבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q@A@BCDC E F F I JKKNNQIDDGGJIKQ_#b&d(f(h*j.l0l0p4q7u9w;y=z>~B~Aђ`Ҕ`ΉOÄM ɉۀ@6܃Fb\ކILMQSTXY]_`dfhjlmqsuuxz{˪ΰΰǦ쮅髃驀詀}}zzyܙmړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q~B~CА[ԘeΉPN':FމMۀAV܄GdߎUކILMQSTXY]_`dfhjlmqsuuxz{˪ΰΰǦ쮅髃驀詀}}zzyܙlړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q~BCώXӕdΉQѼQ([#ȾމMۀAt݅IdSކILMQSTXY]^bdfhjlmqsuuxz{˫ΰͮá쮅뭃詀詀}}zzyܙlړdړcבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q~BCώWԙgϊRS26xމLۀB݈MbމNކILMQSTXY]_`dfhjlmqsuuxz{ͯΰͮĢ쮅髃驀詀}}zzyܙlړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q::986688798:88:??ABCDC E F F I JKLLOPHBBEEHIIKRb&d(f(h*j.l0l0p4q7u9w;y=z>~BC͉QԗfϋSV6'"ވL ۀ@݉OaވLކILMQSTXY]_`dfhjlmqsuuxz{ͯΰͮĢ쮅髃驀詀}}zzyܚkړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q@ABCDC E F F I JKLLOPIABEFFGJJP`%d(f(h*j.l0l0p4q7u9w;y=z>~BC̈PԘeύVЇKGbk6ƯވL ۀAT_݅G߆ILMQSTXY]^bdfhjlmqsuuxz{ίΰͮĢ쮅뭃詀詀}}zzyܗiړdړcבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q~BCˆLԕbюYψLie 1 MވKۀAގV^݄G߇JLMQSTXY]_`dfhjlmqsuuxz{ͯΰͮĢ쮅髃驀詀}}zzyܖiړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q~BC˄JӕaёZЈMoh C?݆IہAZX݄G߇JLMQSTXY]_`dfhjlmqsuuxz{ ͯΰͮĢ쮅髃驀詀}}zzyܖiړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q~BCʃGӔ`ғ]щNkL ' s~=,ہC[V݄G߇JLMQSTXY]^bdfhjlmqsuuxz{ŸίΰͮĢ쮅뭃詀詀}}zzxܗiړdړcבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q~BɀCʁFӒ_ӓ^ъOoRf 9݇K~>OہC^ދQ݄G߇JLMQSTXY]_`dfhjlmqsuuxz{ßͯΰͮĢ쮅髃驀詀}}zzwܖiړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q=::986688798:88::>ABCDC E F F I JKLLOPH~?AACEFGGIQd(f(h*j.l0l0p4q7u9w;y=z>~BɀCʁFґ[ԕbҊPr>2ē݇J~>`܃E\߉N݄G߇JLMQSTXY]_`dfhjlmqsuuxz{ƣͯΰͮġ쮅髃驀詀}}zzߠuܖiړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q=::986688798:88::<@BCDC E F F I JKLLOPF}>?BADEEHHPb&f)h*j.l0l0p4q7u9w;y=z>~BɀCʁFяXԕ`ӊOτr *49݆J~>܅I[݇J݄G߇JLMQSTXY]^bdfhjlmqsuuxz{Ƥίΰ̭Þ쮅뭃詀詀}}zzuܖiړdړcבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q=::978887998:::9;;?BCDC E F F I JKKNOPF|>}@@BBCFFHN_&f)h*j.l0l0p4q7u9w;y=z>~BɀCʁFюVԗcԋPc< ; §݆I~?܆KZ܅HބG߇JLMQSTXY]_`dfhjlmqsuuxz{ǥͯΰˬ쮅髃驀詀}}zzuܖiړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=q}>}AB~CDDGGL]%f)h*j.l0l0p4q7u9w;y=z>~BɀCʁFόR֖bʌU#%:݆I~?ފOY܃EބH߇JLMQSTXY]_`dfhjlmqsuuxz{ɧͯΰˬ쮅髃驀詀}}zztܖhړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEuCuAs=qACDC E F F I JKLLOPGz=|?}?~@}ADEFFKZ$f)h*j.l0l0p4q7u9w;y=z>~BɀCʁFЉPϖb}{9¼݆I>ߋQW܃DބH߇JLMQSTXY]^bdfhjlmqsuuxz{ʩίΰˬ쮅뭃詀詀}}zzsܖhړdړcבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q~BɀCˁFψMx2K݅H =ߌSߌR܃DބH߇JLMQSTXY]_`dfhjlmqsuuxz{ʪͯΰˬ쮅髃驀詀}}zzrܖhړdړcؑaՏ_Ӌ[ԋYщXχV΅T̃P̀OɀM~K|IzGxEuCuAs=qCDC E F F I JKLLOPCx<y>{@|?}@~AD~EEHU!f)h*j.l0l0p4q7u9w;y=z>~BɀCʁFe+ )܀A?ߍVߊO܃DބH߇JLMQSTXY]^bdfhjlmqsuuxz{̬ίΰˬ쮅뭃詀詀}}zzrܖhړdړcבa׏_Ս]ԋ[ӉWчVЅT΃PˀOˀM~K|IzGxEuCuAs=q~BBZ0 2F|;A?V݇M܃DބH߇JLMQSTXY]_`dfhjlmqsuuxz{̯ͮΰˬ쮅髃驀詀}}zzrܖhړdړcؑaՏ_Ӌ[ԋYщXχVυT̃P̀OɀM~K|IzGxEvCuAs>q{?|@}A|D}E~EPf)h*j.l0l0p4q7u9w;y=z>}@UC0݄G|;YځAߍUޅI܃DބH߇JLMQSTXY]_`dfhjlmqsuuxz{̯ͮΰˬ쮅髃驀詀}}zzoܖhړdړcؑaՏ_Ӌ[ԋZ҉XЇVυT̓Q́OʀM~K{HyFvDt@s?p=n;l9h5h4f2d.b,`*^(\&Y$Y"W!SQPNLKIFFC B ? ?=::986688798:88:;:<==BD E F F I JKLLOP}>v;x=y>x?z@{A|B}D|C}EPf)h*j.l0l0p4q7u9w;y=z=PH!%=݄G|;y܂DߍU܄G܃DބH߇JLMQSTXY]^bdfhjlmqsuuxz{ίήΰ̬쮅뭃詀詀}}zzޛnݗg۔eړcؑa׏_Ԍ\ҊZχW̅UʂRǀO|M|IxGuFsDq@o>o=k9i9g7d3c1a/_,^,\)Z'X%W#U!TRPPMKKHFFE A A ?=::978887998:::9;<;==AD E F F I JKKNOPw;u<w;x<w?y@zA{@|C}D|DNd)h*j.l0l0p4q7u9w;x;~JY -݄F|;܃GތRۂD݄DބH߇JLMQSTXY]_`dfhjlmqsuuxz{Ƥ̯ͮΰͯƥ쮅髃骀詀~}{yݚmڔg֑cԍ`ь\͈[ʇWȃUƁS~R|NzKxIvFtErCpAn?m=l;j:h7f5e4b2b0_,_,]*[(X&X$U"USPPNKKIFFC B ? ?=::986688798:88:;:<=>>A E F F I JKLLOQq9u;v<w=v>x>y?zA{A|B{DMb(h+j.l0l0p4q7u9v9~Hd{/-݃F|9܆IދQہB݄DބH߇JLMQSTXY]_`dfhjlmqsuuxz{ˬ̯ͮΰΰ̭ǥ쮄ꬃ詁|ߢz۠vڝuԔiЍb΋_ˉ\ɆYDŽWÁUÀS~Q|OzNzJwHwFuFsDqBn@n>m>@D F G I JKLLOPr8s9u:v;u<w?x@yAzB{CzCLa'h+j.l0l0p4q7t7{Ggz(݃E|;ۇKމO݁B܄DބH߇JLMQSTXY]^bdfhjlmqsuuxz{ɨͮίίΰαΰͯɫŦ¡쵐겎箉㩃ޣ|ݡzڞx؞v՚sәrϐf̊`ˉ]ˉ[ȇZȅXŃUāUQ|P|NzJwIwFuFsDqBn@n>m?@@B D H JKKNOKq8t:s;u<v=u>w?x?yBzAzCLa'h+j.l0l0p4q5yEiz%܃E|:݈LވMہB݄DބH߇JLMQSTXY]_`dfhjlmqsuuxz{Ȩ˭ˬʪɨȧǦţà贐䮊⫈੄ަۢ}ٟyٞxלv֛vԛtԙrΎd̊`̊]ˉ\ɇZDžXÁVāSR}PzMyJwHvFtErCpAn?m=l;j9h7f5d3b1a/_,^+\)Z'X%W#U!TRPPNKKIFFC B ? ?=::986688798:88:;:<=>?>? @ B D HJLLOIp8s8r9t:u;t<v=u@v@yByBKa'h+j.l0l0o2wClz* a }<|;݉M݆JہB݄DބH߇JLMQSTXY]_`dfhjlmqsuuxz{žàŸﶒ쳎鯋欇䫅ᨃަޥܣ}ۢ|ڠzٞzڟyלvכvԚsԙrΎc̊`ˉ]ʈ[ȆYƄWÁTÀR~P{N|N~Q|O{MyLwJuGuFxKxKvItHsFqDpBn@k<::986688798:88:;:<=>?>@ A A C F FHLOEo7r9q:s;t<s=v>v>wAxBxBKa'h+j.l0l/vAoz"+ {85|;މM݅H݁B܄DބH߇JLMQSTXY]^bdfhjlmqsuuxz{촎볎鲎簌殊嬈㪆⩄੄ংߦܣ}ۢ|ڡzٞyٞxלv֝v՝vԛuҕmѓkВiԗnҖmѓjӖoԘpҗoѕmѕmҗoѕmДlϓjΒi͑h̐g̑h̑hʏgɍeɌdNJbƉ`ň^Å]XU~R|P{OyMxKuGpCoAm?i:a2`/^.V$SPEE> 98877777998:::9;<;=>?>@ A A D D E FHK?n7q9r:q;s<t;s<u=v@wAwAJa'h+j.k.t>sy%%9{8C~>݈MۂDہB݄DބH߇JLMQSTXY]_`dfhjlmqsuuxz{찉갊鰊篊毊篋母尌築嬈㪆⩄ূߧަާߨ੅ઇ㭉䭊㮋富䮋⨂ᦀߥ~ߥ~ޤ}ޤ~ݥ~ܣ}ۢ|ۡ{ڠzٟx؞xםv֜v՛tԚsҙrҘqЗpϕnϔm͒k̑iːhɎeɍdȋbƉ`ň^ć]…[„YWU~S}QzNwIuGsEoAm>k=f6d3`/]-Z(POFD<:678988:;:<=>?>@ A A D E FEFIu9h4 n7p9q:r;q<s=t>u>v?v@J`'h+i,sl@ A A D E FEFJh3 e2g3j5n8q:r<q=s>t?u@u@I`'g)qm;k;i9h7h7h6g6g5f4d2c0a-_-^*Y%TLE?=>>?@ A D E FGHHd/ d1e2f3h4j6p:r<q<s?s>t@I_%vBj*%u:z8ۂC݇J@ۂC݄DބH߇JLMQSTXY]_`dfhjlmqsuuxz|}{z{|~䧀䨂媄讈벍žßߞﻗ췔붓굒貎欅婃㨁}ޣ|ݡzݢy㴕ⳓᲓ౑᳓ŭ몪⿧ᾦྥ߽߼߻ݺݹܷ۶۶۴С̙v˗sʖrʖrXxJvGtEtErDpAo@n>l=lt?s?Gn>m' (k͏XKz8ۃD܅G@ۂC݄DބH߇JLMQSTXY]_`dfhjlmqsuvwwuvwxy|~橃ꮇﴍžßߞߞ﹕£ħ͵ѻζ̻˻˺ֱѩ̟`[k;c1c1c0c1d2e2f3f4g3g5g3g4g4g3g3h4h3g3f1d/c.b-Z%RKE E Gx9b/ d0c1 d2f3g4f5g6i8n<r=s>t`Aa((6iُRVz8ۃE܄F@݂C܄DބH߇JLMQSTXY]^bdfhjlnqrsqqqruw{誂žžßßģ̰ԽŲֳ͡ÐkzOe3b.c/c1d1f2g3h4h4g4i4i4i4i4i4h3g1f0e/[&Tk5 b/ b0 c1 e3d4f5g6f7g6h8k;naEW%mӔ\ېSbz8ۄFځD@ۂC݄DބH߇JLMQSTXY]_`dfhjlmmlޚmޛnޛoߝqw~ﮃȧӸðֱȖsvHe1b,d/e0f1h3g2g2i4i4j4k5k4j4d0sC o?h8d5b1c3d3f6g5f6g:jgPW! sxNjTՒZِUmy7z8ۃEڀA@ۂC݄DބH߇JLMQSTXY]_`dfhihݗfܗhܗjݚmqy~Ǧӹڸ˙v|Ph3c,d.g1h3j3k5k3l6P'tE!tE"tD!tE!pAj;f7d4e4g;l~kT#HWъPՒYՒVѐW:vy6;|:܃Dځ@@݂C܄DބH߇JLMQSTXY]^bdecܕcڕcۖfߚksy}ˬٶƑij5d-g0i3O'sE!sF"tF#uF#uF#tF"uF"tE!p@lE#rQ#"]φKωNՑX֓XِTWqy6M|;ۂD?@ۂC݄DބH߇JLMQSTXY]_a_ڐ_ؑ`ڔdjqwz|~ƣݽnPqBq@rBrD!tD!sD!sF!uF"uE yY:A& fʅJΆKψMՑW֒XؐUXiy6~~=ۂC~>AۂC݄DބH߇JLMQSTXZ\ݑ[؍[֎\ےaiosvxy{}д~}Ja?~=AۂC݄DބH߇JLNߋQۉPԇP؋U^dghkmpṵ?sPYXXXYWXXVWUUVTUUSSZ_"UQQRPQQOPPNOOOKuyt@B@1' %V}@ɀCˁGͅH͇LψMҎS֒W֒W˿Vx5>}>=A݂C܄DބH߇J߉LވMօMԈPX_begjnt ^%XXXXWUWVTVUSTTRSQT]!XOQOPPNOOMNNLNKQsZ~~~yyyUBCA>7' ~]y>}BɀCˁGͅH͇LψMӎS֒WגWŋUy6~=~<=AۂC݄DޅHކJۆJԄKڊQY]`adk}ãW~cVUUVTUUSTTRSQQRPPQZZPNOOMNNLMMKLLJ!\0~~~pppnnnooopppHCC?>;8-& tes:t;{?ȀDˁGͅH͇LψMӌQՑV֒WʋRw3x6~=|;=A܂C܄E܄FׂHԃKSY[\_gzƨ\&TUSTTRSQQRPQQOPPNSYRMNLMMKLLJKKKIF ~~~ooonnnooooooqqqpppqqqrrr~~~l˻CDC?>;64/) loG~Ax=w>|CʂFͅI͇LψMӍRՑV֒WΌRw3=z8}<|:>A܂CۃCցF؄JSWXZbwĤirSRSQQRPQQOPPNOOMMOWULKLLJKKKKIJJHG Tw\xxxpppooooooqqqrrrrrrrrrqqqrrrwwwVFEC@>;74/,+.) kwFÁD́D|Az@ǀEͅI͇LЈMыPՐUגWؔYIэRw3Sy6};|:>܀AAրDڅJRUV[n"e5PPQQOPPNOOMNNLMMKSVNJKKIJHHHIGG HG W&zzzxxxwwwppprrrrrrrrrqqqsssrrruuu}}}iɴ=875755220,-;? dʶӔbͅÍC΃DτFC}CɃH·LЈMыQՐTՐVؓXZҏVw3zz6|:}:}>?~A܅JPRUa찆ROPNOOMNNLMMKLLJJMTPIJHIIGH HHFG G E Ccqe{zzyyytttqqqqqqsssrrrtttssswww^ë!  %,:: aݯҏY΃F΃EЅF́FɁF̆KЉNыQՐTՐTؓXxӒZw2z8|8};~=~@ކINPUrǫ@sMLMNNLMMKLLJKKKIJIQRKHG HHFG G E F F F D D /Z6~|~yyysssrrrtttssssssuuu{gé)--  a̷؟pщMυEцFІF̄H·MҌQՏRבTٓWՕ_w3x7{9{9}>܃GLMWꭃW!LMKLLJKKKIJJHIIGKQMG F G E F F F D E E E C C Hvwuvvvrrrtttsssttt}}}}f= }' a߳ԑYцHӇG҈H·LҌPՏSՑTؒW֙e w3y5{9z:܃DJK\츕jsLJKKKIJJHIIGH HHFG NNGE F F D E E C D D D B B BJcNutussstttfC||}*   \ƬטdӉIԈHІIωNԏSՐVٓWםk x3w4y8~>GI[¥4j@G JJHIIGH HHFG G E F E JNJE E C D D D B C C C ABA Lvww|fH#zy{}} {}(LιڟmԋLՉJχJэP֑VדVڢs܊Qw3w5{;CFY¥V"H GH HHFG G E F F F D E D E LKE C B C C C ABB B B @ @@hyjxbD$ zwxy|}}|y"RܢqՌMԊJωKՐTדWܧ{u1%x2x6ށ@DUçkrIF G G E F F F D E E E C D D C FLFC A BB B B @ AAAA?@8d=vbB% ytuvyy|}}vy&Vܠo֍OщJҌQؓXۡov38v2{;AI;mDC F F D E E E C D D D B C C CB JIC A@ AAAA?@@@>> Er]>!| uqrsvvyy|}}x v{% gҿۜf׍MЉKגWؓW=w3Tv3ހ>@讄U$C E C D D D B C C CAB B B AD JF AA?@@@@>???=>LtPsV6{v roorssvvyy|}~|sv#(sǫٓWҊJԐTؔXT߳w4wx5?UR)~}x}IC B C C C AB B B @ AAAA@F GB ?@>????==>>=I¼}Ky,tp mlloorssvvyy|}|rq!y&=ୀ׏PҌOؓXtᷓv3z8~<ŪB ooTU|[B AB B B @ AAAA??@@?AG E ?>?=>=>>><=<>KtOI"m jihijmmprssvvyz}sms$Rܘ^ҊLړW⻚w3|8QGmp5:j@=AAAA?@@@@@>??>C E B >=><><<<=;=;HоqGlceefijjmmprssvwyvjo#x  kᮁՍNגV㿠w2{8鴐mspy{+`1=@@@@>?????===>D D ?<<=<===<;9Nc''_1yb_abcffiilloorstvui h"s%GӿْV֏RŨw3|7DqrPT#=????==>=>>><<>C B==;=;:8Ma!u3CP\[^_`ccffijjmmprsrhcn%y ~tۖ[ؐRɯ x3|5tErq0QkS D<===>><><<<==<@B >;9<L`u1@KVZ[\\_``ccffijjmnpqf^i&u }}|}@tڕYީz(w3R?)E |s{z]v_L;<=<<=<==<<;:9?KYn'~4>GRVVWY[\\_``ccffiilmnc[f's"z}|z{}}q⯃ڗ\ەXCv2aPl?.rtO{{{wwwssszzzqwo2WE;:8:98DNXgp'1:@HOPQSSVVY[\\_``ccffijk`Wc*r#zzywxy|}}S{ᰅږ\ڕYIw3ځChfpEy Dyt,eTKA==LhxzurrtsssssuuuuuuyyyA\ 2&)+,-.159>DGJKLNPPSSVVY[\\_``cdfgeX~Ud)p!uxwtuvyy|}|{:|ైږ\ڕYJx4t.nekcn*.> t yxpG4100/.0:Qrxyxvvwww|||TwL7;>@ACDFGHJKKNPPSUVVY[\\_`acd\QT$e+r"tusqrsvvyy{y/|ު}ڗ[۔V'x4r,mekqkrTv =(wuQr:222/.--+*-9]ҽśHrN>=ACFGGJKKNPPSSVVY[\]__\QzLW,j+qqqonorssvvxv&||۞iٔX x4it.㴓kcisjpnoy@>v.T210/.-,*)(+,;iήf6iGACEHJKNPPSSVWY[[XM{HQ)d.n"onmkklmprsstw*Ĵ{٘aٓV͸u0w1څIrioulrau)15 v z~O0004588697665:eӹrŘT1kJFILNQTWVOGyDN)_/l"kj ihghilloopo{Oޭؕ[ْTP˴w4w3濤pgnumrvnuR| 9 v\R.9@A??=;:975203bҴpŚb+o,lm3 w?N(_(eddaaabdegghihzTؙcבUu/x4ۇM}u{tlrwmtmt9&=w5d>BBA?=::85331/,3uսɮj\[[WA+}AX^mɪӻܫ֒Y׎QJɰt/`z8ypgnwmtxpv_z*2,~MA@=;;964420.+)'3ǰ֖^ՎOªu/?忥sjqxqvxszK"8xxY=<<:75530/,**(%#:֙fӌOݽ!ῧ y5ۃFͻuntzrxny6,3zVm<:86641//++)'$$!G֛kыOҊK5޿w3~<݅Iμwov~tx[&1݆H䶔x}j}0&%p0}=34420-+)'%%# (LR`\]dzΎŶF̈́G8׵ ܃D~ޅIxZ#(   D_:45531.,,*(&$!!#0:;/.-:;;۴ˆNʁDѯֲ݇IGޅHaȳK_   )ca>676642/--+)'$"" +fn3-,222102---Z[[ýΖi{?DwЫ݊P"ދQR䯉ASs-  aIM3yqXXYL;:;::975520..,)(%##!#3FJ522435132021/00:;;شƁI{BƀG;үߏWVލUbŬ)# XN [AB@>;9974220-++)%%# "5TX956788687657356243233102-/.BCCÿȸ˔js7ڿw>I1ˣޗd(aZ}˴E." rz9kDCA?=::85331.,,*(&$!)<>>;:;:;<9:9879576546435132122//0///zzzwڨRΏ@ɅQwTikiD̊ẢPϒtڨݳȶɓin4߼s:}H4ɟݚk+ڝpߚiyȱ1-oTXA?=;996442/--+)'%"  7ag?9:===<==9:<89;898568565455324021/10-..VVWnע6mjllnj-Tdonmnnmn+|ֱؼčbk/Ըo6|I=Ȝ{ՠxuޛktѺZ+%~o!eH>><:85530..,)'%#!!(>KN@>?=@?<=?<=<;<;:;;78:787457344243213102.//576\Ә"rknmononp-f%VkpoqooptZИүOk2Ǻ{I|I:ŘvɥWo:,j x>`==;866411/-*((&$" 5yC@@BBCABB???>?>;<>;<=:;:9::6796765664351321220/1*++oppXҖ%tlnononppppo5b[pqqqqpsD̍޿չőkm6ٱd)zJsÔp)3Cә) iTN;9775220-++)'%# *>\aDCDDDDABDABA>?A>?@=>=:;=9:<9:9898568465435324021011--.FGGRsc ]lnnonpnnppoqpn2]eqpppq${OЕuת׾ƗtuDݯa'{L{LLm .*)!i_=886331.,,*(&#!!2FJKFFFEEFDEFABC@AC@A@=>@==?<=<;<<89;79:787677354344213/00.00,--(((%&&%&&'('"Z?anpnnpppoooqqq-l'\lrrqxAˋQЖ[ӜܸʼռēpsBݪZzM{N\eT){q8T77442/--+)'$"" *@krIJKHHIGHIFGFCFFCDEBCD?@B?@?;<;:;:98:6796765462431321220//-/.-..,+-++*())('( aCeoppqqqqqqprrq5j `oqw6ɆLϓMДRјl֦̩fk8ѥR}Q|Q__)' &f{QE5530..,*(%##!!2GZ^JJKJJKGJIFGHFFHEFEBCEBCD?@A??A>?>=>=:;=:;<9:9899568565435324021011/.0,.-+--+*,)))'((&.+ iFgpoqqqpqprprrq7gev2DŽF͏IΒKϔGΒȄx֪Լ̫ltHݨ\$ĝG~UVJY!/(eX731//-+(&$$"#IOMQSKLMJMLJJLIJKHIJEHGEEGBCDABDABA>A@=>@=>?<=<9:<89;898788455354243213/10.00.-/--,*++,---,.'(($,)iFgpqpprpprrqsq$r5j.zA̍C͏Ȅ8ɉ'x8ȇŘypDܥY!›C|S]_]9Yd'k6H220.+)''%# 6x~XYZJKLIKKHIJHHJGHIDGFDEFCDE@AC@AB?@?<=?<=>;<;:;;78:78767754644513210200/-//-,.**+=>>RSSCCC-,,$+)rKkrrrrrrsssrrwEʀNÀ=Lj=ʌ,ƃxssxVϙȠf_f:b#!{xH90/,**(&#!!LtuvPQRHIJGJIGGIFGHCDECCE@CB?@B?@A>?>;<>:;=:;:9:96795685654351320210/1/..,--233YZZzzzmnnTTU333"7-zNiprqqqsrrsx-ƀ7ɅQ͆D~ yususu&װ#7%g L1-++)'$"" .rijjGHIEHGEFHEFEBEDBBDABA>?A>>@=>=<==9:<9:;898788455354324223/10.00--.JJKrqq{{{{zzrss?@@$"#+?6\)~qsssrtt y*~/ǂ2Ȅ0Ɓ=wk rtuutv<ɋW4VuKq$f5>-,*(%##!G[\]DEEDEFDEFABCAAC@A@=@@<=?<=<;<;89;78:787677546243213102.//.//NNOtuu|||{{{\]]111!"#`XU׶(āstsrux%|)~,ǁ%wv8sj t tvv uxYϛ ! rD0*)&$$"'eLMNABCBCC@CC@@B?@?>?>;<>;<=:;:9::6796765662331321220/1///888KKKeeejkk@AA%''6,$bC^ĝ||"xsqqux#{'}!|vtt$x2qo v t t v u }}׮Q>"}@*'%%# _nopDEEABB?BA>?A>?@=>=:;=9:<9:9898568457454324011/00../------:;;=>>../&''4)%\W7Yhl@OjyLOdmNoˡvx rrsw!z {v tt tu'y6vm v v u u u2Lj}!g33'&$!!'H,OPQ@AB@A@=>@==?<=<;<<89;89:787677346233677677//0-..,,.+++)**(()'&'.@75Z پMFʒssuyv uv v v uv,{1tm w w w vyJ̙j q;)$"" #|9)N8ggh@>?@|?@A?@?;<;:;:78:679676545334JKKeffRSS768+,,,+-+**())2>8h;]M eqԪtuw t t v v v u ww,|1wn w w v w{hҩE  4##!U:e轤]^^STUI=>>=>>=>>:;=:;<9:9899568455?@@fggwxxgggBCC+,,*,,())9JA%pÜ ⇐ڽ~ s v v u u u w u vx,}3yo w vxvظ~,*!&+2-PQQHIIN<==<==9:<89;8986779:;WXX}}~pqqEDD,,,+++6;8RAQHoʠP͚r v w w w v w v wy+5}wx xxw#1! ]#:+OPQBCC$;<?@ <=>:778567456565;:<;;;233.//655l?><eУ_С+ۿ(Ètwwyyyx yĀ7ˆ)uzyz4ő"); k+@AA>??:;